KEGG   Thermococcus barophilus: TERMP_01753Help
Entry
TERMP_01753       CDS       T01377                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tba  Thermococcus barophilus
Pathway
tba00620  Pyruvate metabolism
tba00680  Methane metabolism
tba00720  Carbon fixation pathways in prokaryotes
tba01100  Metabolic pathways
tba01120  Microbial metabolism in diverse environments
tba01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TERMP_01753
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TERMP_01753
   00680 Methane metabolism
    TERMP_01753
Enzymes [BR:tba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     TERMP_01753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 HpcH_HpaI PEPcase
Motif
Other DBs
NCBI-ProteinID: ADT84728
UniProt: F0LK16
LinkDB All DBs
Position
complement(1543804..1545234)
Genome map
AA seq 476 aa AA seqDB search
MIPKTMSTQHPDNVYIPFFAREPQLGGEDEIIEAFYAFSVLGIEEQMWDFEGKEVDEFVV
KKLLERYPHFFRKHKLGEDFRLTPRVPNPSVEKAEAKLLLETLESISRSADYSKIFYGKE
IAPIFEVILPMTTSANEINRVYDLYKRYIVGKQYKRVYDVKLYEWIGKFFPEEINVIPLF
ETKDAILNSAEILREYLHGKDFEYQRVFLARSDPAMNYGLISAVVYDKYALFKLQELEEE
ESVSIYPIIGVGSAPFRGHLVPENVENVLEEYRGAQTFTIQSSFKYDNPPREVIKAVEKI
KSSKRKEAEPINGQILLILRKYEIEYSKQIKALAKLVREVAKFVPSRRKRKLHIGLFGYA
RDVNGFALPRAIKFTASLYSLGVPPEVLGLNALSEKDVEVISNVYNGIYKDLSLAFRYFN
PKSAEKFKFLRDILKMSQLFEFERNEEHCEITNKILDGEINEELIIKAASIRGFLG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgataccaaaaacaatgagtactcaacatcctgacaatgtatatatacctttctttgct
cgggaacctcagttgggtggtgaggatgaaataattgaagcgttttatgccttcagcgtt
ctcggcatagaagagcagatgtgggatttcgaaggaaaagaggtggatgagtttgttgtt
aaaaagcttctggagaggtatcctcacttctttcgaaagcataagcttggagaggatttt
aggttaactccaagagtacccaatcccagcgttgagaaggctgaagcaaaacttctactt
gaaacgcttgagagcatttcccgttcagctgattattcaaagatattctacggcaaagag
attgccccgatatttgaagttattcttccgatgacaacttcagcaaacgaaattaacaga
gtctacgatctgtacaaacgttatattgttggaaagcagtataagagagtctatgacgta
aagctctacgagtggattgggaaattctttcctgaagaaattaacgtaataccactcttt
gagacaaaagatgcaatactgaactcggctgaaatattgagagagtacttgcatgggaag
gactttgaataccaaagggttttcttggcaaggagcgaccctgccatgaactatgggtta
ataagtgctgtcgtctatgataaatatgccctctttaagcttcaggagcttgaagaagag
gagagtgttagtatttatccaattattggtgtaggcagtgcgccttttagaggccatctt
gtcccagaaaatgttgaaaatgttctggaagagtatagaggggctcagacttttacaatt
caaagctcgtttaaatacgacaatccaccgagggaggttataaaagccgttgagaaaatt
aaaagctcaaagagaaaagaagctgagccgattaatgggcaaatcctcctaattctcaga
aaatatgaaattgagtattctaagcagattaaggctttggccaaattggtaagggaggtt
gcaaagtttgttccctccagaagaaagagaaagctccacattggactgtttggttatgcc
agggacgttaatggctttgcacttccaagggcaataaaattcactgcatctctttattct
cttggcgtacctccagaagttcttggattaaatgcacttagtgaaaaagatgttgaggtc
ataagtaatgtttacaatggtatctacaaagatttaagcttagcatttaggtatttcaat
cctaaatcggctgagaaatttaaattcctaagggatattctgaaaatgagccaactgttc
gaatttgagagaaatgaggagcactgtgagattacaaataaaatactggatggcgagatt
aatgaggagttaataatcaaagcggcgagcattaggggatttttggggtga

DBGET integrated database retrieval system