KEGG   Thermococcus barophilus: TERMP_01956Help
Entry
TERMP_01956       CDS       T01377                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
tba  Thermococcus barophilus
Pathway
tba03030  DNA replication
tba03410  Base excision repair
tba03420  Nucleotide excision repair
tba03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:tba00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    TERMP_01956
   03410 Base excision repair
    TERMP_01956
   03420 Nucleotide excision repair
    TERMP_01956
   03430 Mismatch repair
    TERMP_01956
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tba03032]
    TERMP_01956
   03400 DNA repair and recombination proteins [BR:tba03400]
    TERMP_01956
Enzymes [BR:tba01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TERMP_01956
    6.5.1.6  DNA ligase (ATP or NAD+)
     TERMP_01956
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     TERMP_01956
DNA replication proteins [BR:tba03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    TERMP_01956
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     TERMP_01956
DNA repair and recombination proteins [BR:tba03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     TERMP_01956
   NER (nucleotide excision repair)
    Other NER factors
     TERMP_01956
   MMR (mismatch exicision repair)
    Other MMR factors
     TERMP_01956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2 ZinT
Motif
Other DBs
NCBI-ProteinID: ADT84930
UniProt: F0LL23
LinkDB All DBs
Position
complement(1749695..1751380)
Genome map
AA seq 561 aa AA seqDB search
MLYKELAELYRRLEKTTLKTLKTRFVADFLKKVEDEELLEIVPYLILGKVFPDWDERELG
VGEKLLIKAVAMATGINAEWIENSVKDTGDLGESVALALQKRKQRSFFGQPLTIKRVYKT
LVKVAETTGEGSQDRKLKYLANLFMDAEPIEGKYLARTILGTMRTGVAEGLLRDAIAEAF
RVKPELVERAYMLTSDFGFVTKIAKLEGNEGLSKVTIQIGKPIKPMLAQMAANVREALVE
MGGEAEFEIKYDGARVQVHKDGDKVIIYSRRLENVTKSIPEVVERIKKSIKPEKAIVEGE
LVAVGEGGRPRPFQYVLRRFRRKYNIQEMIEKIPLELNLFDVLYVDGENLIDTPFIERRK
KLESIVEVNQWIKVAENLITKSPEEAEEFYHKALDMGHEGLMAKRLDSVYEPGNRGKKWL
KIKPTMENLDLVIIGAEWGEGRRAHVLSSFLLGAYDPGTGTFVPVGKVGSGFTDEDLVEF
TKMLKPLIKKEKGKFVEIEPKVVIEVTYQEIQKSPKYESGFALRFPRYVALREDKSPEDA
DTLERIAQLYELQERMKAGKR
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgctgtacaaagagttggccgagctatataggagactggaaaaaacaacactcaagaca
ttaaaaacaaggtttgtcgctgattttctcaagaaggttgaagatgaggagcttttggaa
attgtgccctacctcattctgggaaaggtcttcccagattgggatgaaagggaattggga
gtcggtgaaaaattgcttatcaaagcggttgcaatggcaacgggtattaatgcggagtgg
atagagaactcggtgaaagacactggtgatctgggagagagtgtcgcattagcccttcaa
aaaagaaaacaaaggagcttttttggacagcctttgacaataaaaagggtttacaaaact
ctcgtgaaagttgcagaaaccactggagaagggagtcaagacaggaagcttaaatatctt
gcaaaccttttcatggatgccgaaccaattgaagggaaatatctggcaagaacaattctc
ggaacaatgagaacaggagttgctgagggacttttgagagatgcaatagctgaggcattc
agagtaaaaccggagcttgttgagagggcttacatgctaacaagtgattttggtttcgtt
acaaaaatagccaagcttgagggaaacgaaggactgtcaaaggtcacaatccagatcgga
aagcctataaaaccaatgcttgcccaaatggccgctaatgtcagagaagctttagtcgaa
atggggggcgaagcagagttcgaaattaaatacgacggtgcaagagttcaagtccataaa
gatggagataaagtgataatctattccagaagactggagaacgttacgaagtccattcca
gaggttgttgagaggataaagaagagcataaagccagaaaaagccatagttgaaggagaa
cttgtagcagttggagaaggggggaggccaagaccgttccaatatgttttgaggaggttt
aggagaaagtacaatatccaagagatgattgagaaaatacctttggagcttaatttattc
gatgttctttacgttgatggagagaacttaattgatactccttttatagagcgccgcaag
aaattggagagcatagttgaagtcaatcagtggattaaagttgcagagaacttgataaca
aaaagtccggaagaagctgaggaattttaccacaaagccctcgacatggggcatgaaggg
ctgatggctaaaaggctcgattcggtttacgagccaggtaacaggggtaaaaagtggctc
aagatcaagcccacaatggagaacctcgatttggtaatcattggagcagaatggggagaa
gggaggagggcgcatgttctaagctctttcctgcttggtgcttatgaccctggaactgga
acttttgtcccagttggaaaagttgggagcggatttacagatgaagacttagttgagttt
acaaagatgcttaagcctctcataaagaaagagaaagggaaatttgtagagatagaacca
aaagtagtaattgaagttacataccaagagatccagaagagtccaaaatacgagagcggc
tttgcattaagattcccaagatacgtggcattaagggaagacaaaagcccagaagatgct
gataccttagaaagaattgcacagctgtatgagttacaggagaggatgaaagcgggaaag
cgctaa

DBGET integrated database retrieval system