KEGG   Thermus brockianus: A0O31_01698Help
Entry
A0O31_01698       CDS       T04600                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
tbc  Thermus brockianus
Pathway
tbc00020  Citrate cycle (TCA cycle)
tbc00270  Cysteine and methionine metabolism
tbc00620  Pyruvate metabolism
tbc00630  Glyoxylate and dicarboxylate metabolism
tbc00680  Methane metabolism
tbc00710  Carbon fixation in photosynthetic organisms
tbc01100  Metabolic pathways
tbc01110  Biosynthesis of secondary metabolites
tbc01120  Microbial metabolism in diverse environments
tbc01130  Biosynthesis of antibiotics
tbc01200  Carbon metabolism
Module
tbc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tbc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tbc_M00012  Glyoxylate cycle
tbc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A0O31_01698
   00620 Pyruvate metabolism
    A0O31_01698
   00630 Glyoxylate and dicarboxylate metabolism
    A0O31_01698
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    A0O31_01698
   00680 Methane metabolism
    A0O31_01698
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    A0O31_01698
Enzymes [BR:tbc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     A0O31_01698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N Glyco_hydro_3_C DUF4885
Motif
Other DBs
NCBI-ProteinID: APD09806
UniProt: A0A1J0LTX7
LinkDB All DBs
Position
complement(1529026..1530009)
Genome map
AA seq 327 aa AA seqDB search
MKSPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPIILQLLEIPQALRALDGVIMELEDC
AFPLLAGVVATDDPKVAFKDADYALLVGAAPRKAGMERRDLLEMNGKIFTEQGRALAEVA
KKEVKVLVVGNPANTNALIAYKNAPGLNPRNFTAMTRLDHNRAKAQLAKKTGVAVDRIRR
IAVWGNHSSTMFPDLFHAEVDGKPALELVDMEWYEKEFIPTVAGRGAAIIQARGASSAAS
AANAAIEHIRDWALGTPEEDWVSMAVPSQGEYGIPEGIVYSFPVTAKDGEYRIVEGLTIN
EFARKRMEITAQELLDEMAQVKALGLI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagccctgttcgcgtggcggtcaccggcgccgcaggccagatcggttatagcctt
ctcttccgcatcgccgcgggggagatgctgggcaaggaccagcccatcatcctgcagctt
ctggaaatcccccaagccctgagagccctagatggggtcatcatggagctggaggactgc
gccttcccgcttttggccggggtggtggccaccgacgaccccaaggtggcctttaaggac
gccgactacgcccttctggtgggggcggccccccgtaaggcgggcatggagcggcgcgac
ctcctggagatgaacggcaagatcttcaccgagcagggccgggccctggcggaggtggcc
aagaaggaggtgaaggtgctggtggtgggcaaccccgccaacaccaacgccctcatcgcc
tacaagaacgccccgggcctaaacccccggaacttcaccgccatgacccgcctggaccac
aaccgggccaaggcccagctggccaagaagacgggggtggccgtggaccggatccgccgc
atcgccgtctggggcaaccactcctccaccatgttccccgacctcttccacgccgaggtg
gacgggaagccggccctggaactcgtggacatggaatggtacgagaaggagtttatcccc
accgtggcggggcggggtgcggccatcatccaggcccggggggcctccagcgccgccagc
gccgccaacgccgccattgagcacatccgcgactgggccttgggcacgccggaggaggac
tgggtatccatggccgtcccctcccaaggggagtacggcatccccgagggcatcgtctac
tccttccccgtgaccgccaaggacggggagtaccgcattgtggaggggcttaccatcaac
gagttcgcccgcaagcgcatggaaatcacggcccaagagctcctggacgagatggcgcag
gtgaaggccctaggcctcatctaa

DBGET integrated database retrieval system