KEGG   Thiobacillus denitrificans: Tbd_0258
Entry
Tbd_0258          CDS       T00275                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
tbd  Thiobacillus denitrificans
Pathway
tbd00970  Aminoacyl-tRNA biosynthesis
tbd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Tbd_0258
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tbd03029]
    Tbd_0258
Enzymes [BR:tbd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Tbd_0258
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Tbd_0258
Mitochondrial biogenesis [BR:tbd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Tbd_0258
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: AAZ96211
UniProt: Q3SM39
LinkDB
Position
complement(279369..280826)
AA seq 485 aa
MPAPSLSALAAQLAAKQVSSRELAQQYLDRIAALNPTINAFITVDPEKTLAEAAAADALI
AGGAAGPLTGVPIAHKDIFCTDGWLTTCGSKMLANFVAPYDAHVIERCKAAGMPSLGKTN
MDEFAMGSSNETSFFGAVKNPWNAGYVPGGSSGGAAACVAARMAPAATGTDTGGSIRQPA
ALCGITGLKPTYGLVSRYGMIAFASSLDQAGPMAPSAEDCARLLNVITGFDPKDSTSLER
EKEDYTRDLDLPLTGLRVGLPCEFFAEGLNNEVAAAVDAAVNELKKLGATTVEISLANSR
LAIPVYYVLAPAEASSNLSRFDGVRYGYRAPEYADLNDMYAKTRAQGFGAEVKRRIMIGT
YVLSHGYYDAYYLQAQKIRRLIAHDFAEAFKTCDVILGPTAPGTAFKLGEKSDDPVEMYL
NDLYTIPANLAGLPGMSLPCGFDSQGLPIGLQLVGDYFSEAKMLNVAHQYQRVTDWHARQ
PEALA
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgcccgcaccctccctttccgccctcgctgcacaactcgcggcgaaacaggtgtcgagc
cgcgagctcgcgcagcaatatctcgaccgcatcgccgcgctgaacccgacgatcaacgcc
ttcattacggtcgacccggagaagacgctcgccgaggcggcggctgccgacgcgctgatc
gccggcggcgccgccggaccgctgactggcgtgccgatcgcgcacaaggacatcttctgc
accgacggctggctcacgacctgcggctcgaaaatgctcgcgaacttcgtcgcgccctac
gacgcccacgtcatcgagcgctgcaaggccgccggcatgccgagcctcggcaagaccaac
atggacgagttcgccatgggctcgtcgaacgaaacctcgttcttcggcgcggtgaagaac
ccgtggaacgccggctacgtgcccggcggctcgtcgggcggcgccgcggcctgcgtcgct
gcacggatggcacccgccgcgaccggcaccgacaccggcggctcgatccgccagccggcc
gcgctgtgcggcatcaccgggctcaagccgacctacggcctggtctcgcgctacggcatg
atcgccttcgcctcgagtctcgaccaggcgggcccgatggcgccgtcggccgaagactgt
gcgcggcttttgaacgtgataacgggcttcgatccgaaggactcgaccagcctcgagcgc
gaaaaggaagactacacgcgcgacctcgatctcccgctcacgggcctacgcgtcggcctg
ccgtgcgaattttttgccgagggtctcaacaacgaggtcgccgctgcggtcgacgccgcg
gtcaatgaactgaagaagctcggcgcgacgacggtcgagatctcgctcgccaactcccgg
ctcgcgatccccgtctactacgtgctcgcgcccgccgaggcgtcgtccaacctctcgcgc
ttcgacggcgtgcgctacggctaccgcgcccccgagtacgcggacctcaacgacatgtac
gccaagacccgtgcgcagggtttcggcgcggaggtcaagcgccgcatcatgatcggcacc
tacgtgctgagccacggctactacgacgcctactacctgcaggcgcaaaaaattcgccgc
ctgatcgcgcacgacttcgccgaggcattcaagacctgcgacgtcatcctcggcccgacc
gcgccgggcacggcattcaagctcggcgagaaatccgacgacccggtcgagatgtacctc
aacgacctctacacgattccggccaacctcgcgggcctgcccggcatgagcctgccctgc
ggcttcgattcgcagggcctgcccatcggcctgcagctcgtcggcgattatttttccgaa
gcgaagatgctgaacgtcgcccatcagtaccagcgcgtcaccgactggcacgcgcgccaa
ccggaggcgctcgcatga

DBGET integrated database retrieval system