KEGG   Thiobacillus denitrificans: Tbd_0442
Entry
Tbd_0442          CDS       T00275                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
tbd  Thiobacillus denitrificans
Pathway
tbd00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tbd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Tbd_0442
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tbd01007]
    Tbd_0442
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tbd03016]
    Tbd_0442
   03029 Mitochondrial biogenesis [BR:tbd03029]
    Tbd_0442
Enzymes [BR:tbd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     Tbd_0442
Amino acid related enzymes [BR:tbd01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   Tbd_0442
Transfer RNA biogenesis [BR:tbd03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Tbd_0442
 Prokaryotic type
   Other AARSs
    Tbd_0442
Mitochondrial biogenesis [BR:tbd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Tbd_0442
SSDB
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d
Other DBs
NCBI-ProteinID: AAZ96395
UniProt: Q3SLL2
LinkDB
Position
462569..464362
AA seq 597 aa
MRTHYCGAVTAADVGNTVTLCGWAHRRRDHGGVIFIDLRDREGMVQVVVDPDTPAAFKLA
EDVRAEFVLKIEGKVRPRPAGTENPHLPTGMVEVLTLDLDVLNPSLTPPFQIDDETINEN
IRLQYRYLDLRREPMQKNLKLRYRVSKIMRDYLDTHGFMEVETPMLTRSTPEGARDYLVP
SRVHDGMFYALPQSPQLFKQLLMVSGVDRYFQITKCFRDEDLRADRQPEFTQVDLETSFM
GEEAIMGLVEGMIRDMMQKAQGIELPAAFPRMSYAEAMNRYGSDKPDLRVTLEIVDVGDV
MRDVAFKVFATPANDPKGRVAALRIPGGATLSRSEIDGYTEFVKIYGAKGLAYIKVNDVG
QLNEAGLQSPIVKNLSEAALHAVMERTGAQNGDLIFFGADRAKVVNDALGALRLKIGHEK
GHVDGRAWAPLWVVDFPMFEYNEDENRWDALHHPFTAPKDGHEDWLATDPGKCLSKAYDM
VLNGWEVGGGSVRIHREKVQEKVFAALNIGEEERREKFGFLLDALQYGAPPHGGLAFGLD
RLVTLMAGAESIRDVIAFPKTQRASCLMTNAPNVVDEKQLRELHIRLRNPIAADKAA
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgcgtactcactactgcggcgcggtcacggccgccgacgtcggcaacacggtcactttg
tgcggatgggcgcaccggcgacgcgatcacggcggcgtgatcttcatcgacctgcgcgac
cgtgagggcatggttcaggtcgtggtcgaccccgatacgccggcggcattcaagctcgcc
gaggacgtgcgcgccgaattcgtgctgaagatcgaaggcaaggttcgtccgcgtccggca
gggacggagaatccgcacctgccgaccgggatggtcgaggtgttgacgctcgatctggac
gtgctgaacccctcgctgacgccgccgttccagatcgacgacgagaccatcaacgagaac
atccgactccagtaccgttacctcgacctgcgccgcgagccgatgcagaagaacctcaag
ctgcgctatcgcgtgtcgaagatcatgcgcgactacctcgatacgcacggcttcatggag
gtcgagacgccgatgctgacgcgctcgacgcccgaaggcgcgcgcgactatctggtgccg
agccgggtgcacgacggcatgttctacgcgctgccgcagagcccgcagctcttcaagcag
cttctgatggtctccggcgtcgaccgctacttccagatcacgaagtgcttccgcgacgag
gacttgcgcgccgaccgccagcccgagttcacgcaagtggatttggagacctcgttcatg
ggcgaggaagcgatcatgggcctcgtcgagggcatgattcgcgacatgatgcagaaggcc
cagggcatcgaacttcccgcggccttcccgcgcatgagctacgccgaggcgatgaatcga
tacgggtcggacaagcccgatctgcgcgtcacgctcgaaatcgtcgacgtcggcgacgtc
atgagggacgtcgcgttcaaggtcttcgccacacctgccaatgatccgaaaggtcgtgtc
gcggcgctgcggattccgggcggcgcgacgctctcgcgcagcgaaatcgacggctacacc
gagttcgtcaagatttacggcgccaaggggctggcctacatcaaggtcaacgacgtcggc
cagttgaacgaagcgggcctgcagtcgccgatcgtcaagaacctctcagaagccgccttg
cacgcggtgatggagcggaccggcgcgcagaacggtgacctgatcttcttcggcgccgac
cgcgccaaggtggtcaacgacgcgctcggcgcgctgcggctcaagatcggccacgagaaa
ggtcacgtcgacggtcgcgcctgggcgccgctctgggtcgtcgacttcccgatgttcgaa
tacaacgaggacgagaaccgctgggacgcgctgcaccatcccttcaccgcgcccaaggac
ggccacgaggactggctcgccaccgaccccggcaagtgtctgtccaaggcctacgacatg
gtgctgaacggttgggaagtcggcggcggctcggtgcgtatccaccgcgagaaggtgcag
gaaaaggtcttcgccgccctcaacatcggcgaggaagagcgccgcgagaaattcggcttc
ctgctcgacgccctgcaatacggcgcgccgccccatggcggcctcgcattcgggctcgat
agattggtcacgctgatggccggggccgagtcgatccgcgacgtcatcgccttccccaag
acgcagcgcgcctcgtgcctgatgaccaacgcgcccaacgtcgtcgacgaaaagcagctg
cgcgagttgcacatccgcctgcgcaatccgatcgccgccgacaaggcagcctga

DBGET integrated database retrieval system