KEGG   Thiobacillus denitrificans: Tbd_0630Help
Entry
Tbd_0630          CDS       T00275                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tbd  Thiobacillus denitrificans
Pathway
tbd00620  Pyruvate metabolism
tbd00680  Methane metabolism
tbd00710  Carbon fixation in photosynthetic organisms
tbd01100  Metabolic pathways
tbd01120  Microbial metabolism in diverse environments
tbd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tbd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tbd_0630
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Tbd_0630
   00680 Methane metabolism
    Tbd_0630
Enzymes [BR:tbd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Tbd_0630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AAZ96583
UniProt: Q3SL36
LinkDB All DBs
Position
665633..668452
Genome map
AA seq 939 aa AA seqDB search
MNAPQNLLTDDDLRAQVKLLGTLLGQVLLQFAGEDVFEAVETLRRGFADLQQQEDQQRRS
ELMAMIDAMPAGKIELVVRAFSSYFMLVNVAEESFAHRNRRRMLSHGMTLWEGSFDHTLA
DLKAQGLSAGTLQGLINRLHFAPVFTAHPTEARRRAVMEAMRRIFLICDQLYSPSLGVND
QRELEAQLAAEIQIMWRTDELRSAKLEVRDEVRNGLYYVRESLFEAVPKAYSFFERALRK
HYGVNGDGAAPISVPSFIRFGSWIGGDRDGNPFVTADVTEWTVHTQMQAALDEYRARVRE
LRQTLTHSSGWCTPSAPFLERLAEYEAEFGEQVFRGTAVQIYSREPYRRMAAMMLARLDA
NLSYVHQCLADVPSFTSHLAYEDAAAFLADLYLIRDSLISHGDRIIAMQDLQALIRLVES
FGFHLLQLDIRQESTIHTRTVAAVLQQIDPDFDYKGADEAERLKRLSAWTGHIDPIEIDD
SLLDDEARETVAVFRRMAKLKSEVGDEVFGTYIISMTHSASHVMEVMLLARLVGLCGHNG
DAWFCRILVAPLFETVDDLQRSQAILDELLSNKVYRALVAADGNRQEVMLGYSDSCKDGG
ILASNWNLYQAQLSIIALTRRHGVECRLFHGRGGTVGRGGGPTHEAILSQPPGTVNGEIK
FTEQGEMLYYKYSNPETANYEIGMGVTGLLKASATLLKKCEVRYPQDYLDWMRDIAAAGE
TTYRALIATPGFIDYFYENTPVTEIGTLNIGSRPSHRKKADRSLGSIRAIPWVFGWAQSR
HTLPAWYGIGSALKSFVDQHPEGLAHLRAMYAEWPFFRGLLSNVQMALTKADMEIAEEYA
RLCDHPGTPDIYRAIADEFALTVAGVKQVAQIENLLEDNQPLALSISRRRPYIDPINHIQ
VRLLKRYRSESVWESEQDSWLTPLKRSINAIAAGMRNTG
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaccccagaatctcttgaccgacgacgatctgcgcgcgcaggtcaagcttctc
ggcaccctgctcggccaggtgctgctgcagttcgccggggaagacgtgttcgaggcggtg
gaaaccctgcggcgcggctttgccgacttgcagcagcaggaagaccagcagcggcgcagc
gaactgatggccatgatcgacgcgatgccggccggcaagatcgagctggtcgtacgcgcg
ttctcgagctatttcatgctggtcaacgtagccgaggaaagcttcgcgcaccgcaaccgc
cgtcgcatgctgtcgcacggcatgacgctgtgggaaggctcgttcgaccacacgctcgcc
gatctcaaggcgcagggcctgtcggcgggcacgctgcaggggctgatcaaccgcctgcac
ttcgcgcctgtctttaccgcgcatccgaccgaagcccggcgccgcgccgtgatggaggcc
atgcgcaggatattcctgatctgcgaccagctctacagcccgagcctcggcgtcaacgac
cagcgcgagctcgaggcgcagctcgcggccgagatccagatcatgtggcgcaccgacgaa
ctgcgcagcgccaagctcgaggtgcgcgacgaagtgcgcaacggcctctattacgtgcgc
gagagcctgttcgaggcggtgcccaaggcctacagcttcttcgagcgcgcgctgcgcaag
cactacggcgtgaacggcgacggcgcggcgccgatcagcgtgccgagcttcatccgcttc
ggctcgtggatcggcggcgaccgcgacggcaaccccttcgtcaccgccgacgtgaccgaa
tggaccgtgcatacgcagatgcaggcggcgctcgacgaataccgcgcgcgcgtgcgcgag
ttgcggcagacactcacccacagtagcggctggtgcacgccgtccgcgccgtttctcgag
cgcctggccgaatacgaggccgagttcggcgagcaggtgttccgcggcaccgcggtgcag
atctacagccgcgaaccttaccgccgcatggccgcgatgatgctcgcgcggctcgacgcg
aatctctcgtacgtgcaccagtgcctcgccgacgtgccgagtttcacctcgcatctcgcc
tacgaagacgcagcggccttcctcgccgacctgtatctgatccgcgactccctgatcagc
cacggcgaccgcatcatcgcgatgcaggacctgcaggcactgatccgcctggtcgagagt
ttcggctttcacctgctgcagctcgacatccgccaggaatcgacgatccacacgcggacc
gtggcggcggtgctgcagcagatcgaccccgacttcgactacaaaggcgccgatgaagcc
gagcgtctgaagcgcctgtcggcgtggaccgggcacatcgatccgatcgagatcgatgac
agcctgctcgacgacgaggcgcgcgagaccgtcgcggtcttccgccgcatggccaagctc
aagagcgaagtcggcgacgaagtcttcggcacctacatcatttcgatgacccacagcgcg
tcgcatgtgatggaagtcatgttgctcgcgcgcctggtcgggctctgcggccacaacggc
gacgcgtggttctgccgcatcctcgtcgcgccgctgttcgagaccgtcgacgacctgcag
cgcagccaggcgatcctcgacgagttgctgtcgaacaaggtttatcgtgcgctggtcgcg
gccgacggcaaccgccaggaggtcatgctcggctattccgactcgtgcaaggacggcggc
atcctcgcgtcgaactggaacctctatcaggcgcagctttcgatcatcgcactgacccgg
cggcatggcgtcgagtgccggctgttccatggccgcggcggtacggtcggacgcggcggc
ggcccgacccacgaggcgatcctgtcgcagccgccgggtacggtcaacggcgaaatcaag
ttcaccgagcagggcgaaatgctgtactacaaatacagcaaccccgagacggcgaactac
gaaatcggcatgggtgtgacgggtctgctgaaggccagcgccaccctgctgaagaaatgc
gaagtccggtatccgcaggactatctcgactggatgcgcgacatcgcggcggcgggcgag
acgacttatcgcgcgctgatcgcgacgcccggcttcatcgattacttctacgaaaacacg
ccggtcaccgagatcggcacgctcaatatcggcagccggccttcgcatcgcaagaaggcc
gaccgctcgctcggctcgatccgcgcgattccctgggtgttcggctgggcgcagtcgcgg
cacaccctgcccgcctggtatggcatcggcagcgcgctcaagtccttcgtcgaccagcat
ccggaggggcttgcgcacctgcgcgcgatgtacgccgagtggccattcttccgcggcctg
ctgtcgaacgtccagatggcgctgaccaaggccgacatggaaatcgccgaggaatacgcg
cggttgtgcgaccacccggggacgcccgacatctatcgcgcgatcgccgacgagttcgcc
ctcacggtcgccggcgtcaagcaggtcgcgcagatcgaaaacctgctcgaggacaaccag
ccgctggccctctcgatctcgcgtcgccgcccctacatcgacccgatcaaccacatccag
gtccggctactcaagcgctatcgttccgagagcgtgtgggaatccgagcaggactcgtgg
ctcacgccgctcaagcgctcgatcaacgcgatcgcagcgggtatgcgcaatacgggctga

DBGET integrated database retrieval system