KEGG   Thiobacillus denitrificans: Tbd_0659Help
Entry
Tbd_0659          CDS       T00275                                 

Definition
(GenBank) superoxide dismutase, Cu-Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
tbd  Thiobacillus denitrificans
Brite
Enzymes [BR:tbd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Tbd_0659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AAZ96612
UniProt: Q3SL09
LinkDB All DBs
Position
complement(699332..699856)
Genome map
AA seq 174 aa AA seqDB search
MTIRSKMCALALCFVPFAAGAADKTVAMDSVDAAGKGTSVGSVTISESRYGLVFTPALKG
LSPGVHGFHVHEKPSCEAQEKDGKKVAALAAGGHYDPAKTGRHGTPWGDGHLGDLPPLFV
DANGDTSQPVLAPRLKMSDLRGRSLMVHAGGDNHADHPAALGGGGARVACGVID
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcaggtcgaagatgtgcgcgctggcgctgtgtttcgttccgttcgcggcgggc
gccgccgacaagaccgtcgcgatggacagcgtcgacgccgcgggcaaggggacgtcggtc
ggttcggtgacgatcagcgaatcgcgttatggcctggtcttcacgccggcgctcaaaggg
ctctcgcccggcgtacacgggttccacgttcacgagaagccgagctgcgaggcgcaggaa
aaagacggcaagaaggtcgcggcgctcgcagccggtggtcactacgaccccgcgaagacc
ggccgccacggcacgccctggggcgacggtcacctcggcgacctgccgccgcttttcgtc
gacgcgaacggcgacaccagccagcctgtgctcgcaccgcggctgaagatgagcgatcta
cgcggccgctcgctcatggttcacgcgggcggcgacaaccacgccgaccatcccgccgcg
ctcggcggcggcggtgcgcgtgtcgcctgcggcgtgatcgactga

DBGET integrated database retrieval system