KEGG   Thiobacillus denitrificans: Tbd_1553
Entry
Tbd_1553          CDS       T00275                                 

Definition
(GenBank) Ribosomal protein S32
  KO
K02911  large subunit ribosomal protein L32
Organism
tbd  Thiobacillus denitrificans
Pathway
tbd03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tbd00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Tbd_1553
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tbd03011]
    Tbd_1553
   03029 Mitochondrial biogenesis [BR:tbd03029]
    Tbd_1553
Ribosome [BR:tbd03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Tbd_1553
  Bacteria
    Tbd_1553
Mitochondrial biogenesis [BR:tbd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Tbd_1553
SSDB
Motif
Pfam: Ribosomal_L32p
Other DBs
NCBI-ProteinID: AAZ97506
UniProt: Q3SIM2
LinkDB
Position
complement(1637223..1637402)
AA seq 59 aa
MAVQQNKKSPSKRGMHRSHDFLTNPALAVEPTTGEAHLRHHISPNGFYRGRKVVKAKGE
NT seq 180 nt   +upstreamnt  +downstreamnt
atggcagtccaacagaacaagaagtccccgtccaagcgcggcatgcaccgttcgcacgac
tttctgaccaaccccgcactggccgtcgagccgacgaccggtgaagcgcatctgcgtcac
cacatcagccccaacggcttctaccgcggccgcaaggtcgtcaaggccaagggcgaataa

DBGET integrated database retrieval system