KEGG   Thiobacillus denitrificans: Tbd_2085
Entry
Tbd_2085          CDS       T00275                                 

Definition
(GenBank) GTPase
  KO
K03595  GTPase
Organism
tbd  Thiobacillus denitrificans
Brite
KEGG Orthology (KO) [BR:tbd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tbd03009]
    Tbd_2085
   03029 Mitochondrial biogenesis [BR:tbd03029]
    Tbd_2085
Ribosome biogenesis [BR:tbd03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   Tbd_2085
 Prokaryotic type
  GTPases
   Tbd_2085
Mitochondrial biogenesis [BR:tbd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Tbd_2085
SSDB
Motif
Pfam: MMR_HSR1 KH_2 FeoB_N GTP_EFTU RsgA_GTPase Dynamin_N AIG1 PduV-EutP Ras MeaB AAA_22 MMR_HSR1_Xtn Roc Arf AAA_16 SRPRB cobW AAA_33 ABC_tran TniB Septin KH_1 MnmE_helical NTPase_1 KTI12
Other DBs
NCBI-ProteinID: AAZ98038
UniProt: Q3SH51
LinkDB
Position
complement(2177914..2178807)
AA seq 297 aa
MNVSTEYRCGLVAIVGRPNVGKSTLLNRLVGQKVSITSRKAQTTRHRVMGIHTTDRAQFV
FVDTPGFQTRHTSTMNRAMNKRVRETLSDTDVVMMLVEAGRLTREDRQVMELLPKDRPLL
LVVNKVDQAKDRAALMAYLQQVAAAHAFTEIVPVSAKQGSNLDELLKTLEKHLPENPPLF
GEDHVTDQTERQLAAELIREKVFRLCGEEIPYAVAVVIDKFEEEGNLRRIFATILVDRDS
HKAIVIGKGGEKLKTISTQARLDMEHAFDGRVYLEVWVKVKGGWADDLRTLKSLGLD
NT seq 894 nt   +upstreamnt  +downstreamnt
atgaacgtctctaccgaataccgctgcggcctcgtcgccatcgtcggccgtcccaacgtc
ggcaagtcgacgctgctcaatcgcctggtcgggcagaaggtcagcatcacctcgcgcaag
gcgcagacgacgcgtcaccgcgtcatggggatccacaccaccgacagggcgcagttcgtg
ttcgtcgacacgccgggcttccagacacggcacacgagcacgatgaaccgtgcgatgaac
aagcgcgtgcgcgaaaccctgtccgacaccgacgtcgtcatgatgctggtcgaggcaggg
cggctcacgcgcgaggatcgtcaggtcatggaactgctgccgaaggaccggccgctgctg
ctcgtcgtgaacaaggtcgaccaggcgaaggaccgcgccgccttgatggcctacctgcag
caggtcgcggcggcgcacgccttcaccgagatcgtgccggtctcggccaagcagggcagc
aacctcgacgaactgctgaagacgctcgagaagcatctgccggagaacccgccgctcttc
ggcgaggaccacgtgaccgaccagaccgagcgccagctcgcggccgagctcatccgcgaa
aaggtcttccgcctgtgcggcgaagagattccctacgccgtcgccgtcgtcatcgacaag
ttcgaggaagagggaaacctgcggcgcatcttcgcgaccatcctcgtcgaccgcgacagc
cacaaggcgatcgtgatcggcaagggcggggaaaagctcaagaccatttcgacccaggcc
cggctcgacatggagcatgccttcgacggcagggtctatctcgaagtgtgggtcaaggtc
aagggcggctgggccgacgacctgcgcacgctgaaatcgctcggcctggattga

DBGET integrated database retrieval system