KEGG   Thiobacillus denitrificans: Tbd_2247Help
Entry
Tbd_2247          CDS       T00275                                 

Definition
(GenBank) DNA ligase, ATP-dependent, putative
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
tbd  Thiobacillus denitrificans
Pathway
tbd03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tbd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Tbd_2247
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tbd03400]
    Tbd_2247
Enzymes [BR:tbd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Tbd_2247
DNA repair and recombination proteins [BR:tbd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Tbd_2247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AAZ98200
UniProt: Q3SGP7
LinkDB All DBs
Position
2321679..2324219
Genome map
AA seq 846 aa AA seqDB search
MAKRDPLSTYTEKRDFSISPEPVSGGQANEAARSFVVQKHWATRLHYDFRLELDGSMKSW
AVPKGPSLDPADKRMAVHVEDHPIAYNAFEGTIPPRQYGAGKVIIWDKGTWVPLVDPRRG
YEEGHLKFELHGHKLQGRWALVRMKGKGEAKEPWLLIKEKDEHARPAADYSVVDALPDSV
ADKDDAAAVTKAAAPRRRAGETPRPRKARAAKATEKAGAAAVEGAVKSALPATLAPQLAT
LADKPPDDGDGWVYEVKFDGYRMLARIDKTVRLFTRNGNDWSHRLAPLVKAIEAAGLRPG
WLDGEVVVPNAAGVPDFQALQNAFDQARADAIVYYVFDLPFYDGYDLRAAPLVARKALLA
GLLDTPHSDALRLSESFDAAPRDILASACKMGLEGVIAKRRDAPYVSRRSTDWLKLKCTR
RQEFVIGGYTDPRGSRPGLGSLLLGVHDARGELVYAGNVGTGFDHGTLGDLRKKLAAHAR
DTSPFVDATGIAGKPHWVDPKLVAEVSFGEWTKSGRIRHAVFEGLRLDKRAASVVREEPV
AAAAAAPRLPADLKVSHPERVVDKASGTTKLALIAYYARVAPLMMPHLKARPVSLVRAPD
GVGGSLFFQKHVEASQMRGVKTLPRTLDPGHAPLIEVAAAEGLLTAAQMNVIEFHTWNAR
KTRIDKPDRMTFDLDPGEGVGWTTVQESAHLVREFLSQLGLASFLKTSGGKGLHIVVPLK
RLHDWDTVKDFSHAIVRHLARTLPQRFAAKSGPKNRVGKIFIDYLRNGFGATTVAAWSVR
ARPGLGVSVPLEWRELDALTSAAQWTVPNIDSRLEIGNAPWEAYDASSHSLTRAMKTLGH
VPKTPA
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcgcgacccgctttccacctacaccgagaaacgcgatttttcgatcagcccg
gagccagtgtcgggcggccaggccaatgaggcggcgcgctcgttcgtcgtgcagaaacac
tgggcgacgcgactgcattacgacttccggctcgaactcgacggcagcatgaaaagctgg
gccgtaccgaaggggccgagcctcgaccccgcggacaagcgcatggccgtgcacgtcgag
gaccacccgatcgcctacaacgcgttcgaggggacgatcccgcccaggcaatacggcgcc
ggcaaggtcatcatctgggacaaaggcacctgggttccgctcgtcgatccgcgccgcggc
tacgaggaaggccatctcaaattcgaactccacggtcacaagctgcaggggcggtgggcg
ctcgtgcgcatgaagggtaaaggcgaagccaaggagccctggctcctgatcaaggaaaag
gacgaacatgcgcgccccgccgccgactacagcgtcgtcgacgccctgcccgacagcgtc
gcggacaaggacgacgccgcggccgtgacgaaggccgcggcgccgcggcggcgtgcaggc
gaaacgccgcgcccgcgcaaggcgcgcgcggcgaaggccacggaaaaagcgggcgcggcg
gccgtcgagggcgcggtgaaaagcgcgctgccggcgacgctggccccccagctcgcgacg
ctcgccgacaagccgccggacgacggcgacggctgggtctacgaggtaaagttcgacggc
tatcgcatgctcgcgcgcatcgacaagacggtccgcctgttcacgcgcaacggcaacgac
tggagccacaggctcgcgccgctggtcaaggcgatcgaagcggccgggctgcggcccggc
tggctcgacggcgaggtcgtcgtaccgaacgcggccggcgtgccggacttccaggcgctg
cagaacgccttcgaccaggcgcgcgcggacgccatcgtctactacgtcttcgacctgccg
ttctacgacggttacgacctgcgcgcggcgccgctcgtcgcgcgcaaggcgctgctcgcg
ggcttgctcgacacgccgcacagcgacgcgctgcgcttgagtgaaagcttcgacgcagcg
ccgcgcgacatcctcgcatcagcctgcaagatggggctcgagggcgtgatcgcgaagcgc
cgcgacgcgccctacgtctcgcgccgctcgaccgactggctcaagctcaagtgcacgcgg
cgccaggaattcgtgatcggcggctacaccgatccgcgcggctcccggcccgggctcggc
tcgctgctgctcggcgtgcacgacgcgcgcggcgaactcgtctacgccggcaacgtcggc
accggcttcgaccacggcacgctcggcgatctcaggaaaaaactcgcggcgcacgcgcgc
gacacgagcccgttcgtcgacgcgacgggcatcgcgggcaagccgcactgggtcgacccc
aaacttgtcgccgaggtgtcgttcggcgaatggaccaagagcggccggatccgccacgcg
gtgttcgaggggctgcggctcgacaagcgcgcggccagcgtcgtccgcgaggaacccgtt
gccgcggcggccgccgccccgcgcctgccggccgatctgaaggtctcgcacccggagcgc
gtggtcgacaaggcgagcggcaccaccaagctcgcgctcatcgcctactacgcgcgggtc
gccccgctgatgatgccgcacctgaaggcgcggccggtgtcgctggtgcgcgcgcccgac
ggcgtgggcggatcgctctttttccagaagcacgtcgaggcgtcgcagatgcgcggcgtc
aagacgctgccgcgcacgctcgacccgggtcacgcgccgctcatcgaggtcgccgcggcc
gagggcctgctgaccgcagcgcagatgaacgtgatcgaattccatacctggaacgcgcgc
aagacccggatcgacaagccggaccgcatgaccttcgacctcgatcccggcgagggcgtc
ggctggaccacggtgcaggaatccgcccacctcgtgcgcgaatttctctcccagctcggg
ctggcgtcgtttctcaagaccagcggcggcaagggcctgcacatcgtcgtgccgctcaag
cgcctgcacgactgggatacggtcaaggatttttcgcacgcgatcgtgcgccatctcgcg
aggacgctgccgcaacgctttgccgccaagagcgggccgaaaaaccgggtcggcaagatc
ttcatcgattacctgcgcaacggcttcggcgcgaccacggtcgccgcctggtcggtgcgc
gcacgcccagggctcggcgtctcggtgccactcgaatggcgcgaactcgacgcgctcacg
agcgctgcgcagtggacggtcccgaacatcgactcgcgcctcgaaatcggcaacgcgccg
tgggaggcctacgacgcctcgagccacagcctgacccgggcgatgaagacgctgggccac
gttccgaaaacgccggcatag

DBGET integrated database retrieval system