KEGG   Thiobacillus denitrificans: Tbd_2256Help
Entry
Tbd_2256          CDS       T00275                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tbd  Thiobacillus denitrificans
Brite
Enzymes [BR:tbd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Tbd_2256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AAZ98209
UniProt: Q3SGN8
LinkDB All DBs
Position
complement(2330891..2331595)
Genome map
AA seq 234 aa AA seqDB search
MNALKMAWTAPPTRQTMETGMSAGECGICTSTIEAMRFPYELPPLPYGPDALRPLISGNT
IRFHHREHHQRYIDGLNRGIDDTEFGAMPLRAVIRATAGKPETAVIFNNAAQAWNHAFYW
DSLTPQGGGLPPPALRKMIDASFGSVDACLRQLAHAAIAQFGTGWVWLARDDKKIRVVRT
CGADNPLTRELTPLLAIDLWEHAYYLDYQNRLEDHVSGVIGRLVNWDFAAKNLV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcattaaagatggcatggaccgcgccgcccacgcgacagaccatggaaaccggg
atgtccgcaggcgaatgcggcatctgcacgtccacgatcgaggcgatgcgcttcccctac
gagcttccgccactgccgtacgggccggacgccctgcggccgctgatttccgggaacacg
atccgtttccaccatcgcgagcatcaccagcgttacatcgacggactcaatcgcgggatc
gacgacaccgagttcggggcgatgcccttgcgcgcggtcatccgcgcgacggccggcaaa
ccggagacggccgtgatcttcaacaatgccgcgcaggcgtggaaccacgccttctactgg
gacagcctcacgccgcaaggcggcggcctgccaccgcctgcgctgcggaaaatgatcgac
gcgtcgttcggctcggtcgacgcctgcctgcgccagctcgcccacgcggccatcgcgcag
ttcggcacgggctgggtgtggctcgcgcgcgacgacaagaagatccgggtcgtgcggacc
tgtggtgccgacaacccgctgacgcgggagctgaccccgctgctcgcgatcgacctgtgg
gaacacgcgtactacctcgattaccagaaccggctcgaagatcacgtcagcggcgtgatc
ggccgcctggtcaactgggatttcgcggcgaagaatcttgtctga

DBGET integrated database retrieval system