KEGG   Thiobacillus denitrificans: Tbd_2782
Entry
Tbd_2782          CDS       T00275                                 

Definition
(GenBank) arginyl-tRNA synthetase, class Ic
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
tbd  Thiobacillus denitrificans
Pathway
tbd00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tbd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Tbd_2782
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tbd01007]
    Tbd_2782
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tbd03016]
    Tbd_2782
   03029 Mitochondrial biogenesis [BR:tbd03029]
    Tbd_2782
Enzymes [BR:tbd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     Tbd_2782
Amino acid related enzymes [BR:tbd01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Tbd_2782
Transfer RNA biogenesis [BR:tbd03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Tbd_2782
 Prokaryotic type
   Other AARSs
    Tbd_2782
Mitochondrial biogenesis [BR:tbd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Tbd_2782
SSDB
Motif
Pfam: DALR_1 Arg_tRNA_synt_N tRNA-synt_1d tRNA-synt_1f tRNA-synt_1 tRNA-synt_1g YHYH
Other DBs
NCBI-ProteinID: AAZ98735
UniProt: Q3SF80
LinkDB
Position
2863428..2865101
AA seq 557 aa
MSSTHPLKDQLALLIEAALEALAPDAPVSLEIERPKNPTHGDFSSNAAMQLARPLKRNPR
ELAQLIVTELPASTLVAKADIAGAGFINFHLTPAAWHGIVRQVRTAGAQFGRAQRETPQR
VLIEFVSANPTGPLHVGHGRQAALGDALCNLYAAQGWDVYREFYYNDAGVQIATLAASVQ
ARARGLQPGDATWPEAAYNGDYIADIARDFLAGKTVKSDDREFTASGDVDDLDSIRQFAV
AYLRHEQDLDLRAFAVHFDNYYLESSLYTDGRVDATVQRLVAAGKTYEQDGALWLRTTEY
GDDKDRVMKKSDGTYTYFVPDVAYHIAKWERGFARAINIQGTDHHGTIARVRAGLQAASV
GIPEGYPDYLLHTMVRVMRGGEEVKISKRAGSYVTLRDLIEWTSKDAVRFFLLSRKADTE
YVFDIDLALARNNDNPVYYVQYAHARICRVFEEWSGDVATLADADLAPLEAAHELALMQR
LAEYPETVASAARDLAPHLLVHYLQMLAGDFHAWYNAEKFLVADEATKRARLALADATRI
VIVNGLALLGVDAPEKM
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgtccagcacgcatcccctcaaagaccaactcgccctcctgatcgaagccgcgctcgaa
gcgctggcgccggacgcgccggtcagtctcgagatcgagcggccgaaaaatccgacgcac
ggcgacttctcgagcaacgcggcgatgcagctggcgcggccgctgaaaagaaacccgcgc
gaactcgcgcagttgatcgtcaccgaactgccggcgtcgacgctcgtcgccaaggccgac
atcgccggcgccggtttcatcaacttccacctcacgccggccgcctggcacggcatcgtg
cggcaggtccgcaccgccggcgcgcaattcgggcgcgcgcaacgcgagaccccgcagcgc
gtgctgatcgagttcgtgtcggccaacccgaccggcccgctgcacgtcggccacggccgc
caggcggcgcttggcgacgcgctgtgcaacctctacgccgcgcagggctgggacgtgtac
cgcgagttctactacaacgacgcaggggtgcagatcgccacgctcgcggcgagcgtgcag
gcccgcgcgaggggcctgcagcccggtgacgcgacgtggcccgaagcggcgtacaacggc
gactacatcgcagacatcgcgcgcgacttcctcgccggcaagactgtgaaatccgacgat
cgcgaattcacggcgtcgggcgacgtcgacgacctcgattcgatccgccagttcgcggtc
gcctatctgcgccacgagcaggatctcgacctgcgcgccttcgcggttcacttcgacaac
tactatctcgaatcgagcctctataccgacggacgcgtcgacgccacggtgcagcgcctc
gtcgccgccggcaagacctacgagcaggacggcgcgctgtggctgcgcacgaccgagtac
ggcgacgacaaggaccgcgtgatgaagaagtccgacggcacctacacctacttcgtgccc
gacgtcgcctaccacatcgccaagtgggagcgcggcttcgcgcgcgcgatcaacatccag
ggcaccgaccaccacggcacgatcgcgcgcgtgcgtgccggcctgcaggccgcgagcgtc
ggcattcccgagggctatcccgactacctgctgcacacgatggtgcgcgtcatgcgcggc
ggcgaagaggtcaagatttccaagcgcgcgggcagctatgtcacgctgcgcgatctcatc
gagtggacgagcaaggacgcggtgcgcttcttcctgctctcgcgcaaggccgacaccgaa
tacgttttcgacatcgacctcgcgctcgcgcgcaataacgacaacccggtgtactacgtg
cagtacgcgcatgcacgcatctgccgggtcttcgaggagtggagcggcgacgtggcgacg
ctcgccgacgccgacctcgcgccgctcgaagctgcgcacgagctcgcgctgatgcagcgc
ctcgccgagtatcccgaaacggtggcgagcgcggcacgcgacctcgcgccacatctgctg
gtgcactacctgcagatgctcgccggcgacttccacgcctggtacaacgccgagaaattc
ctcgtcgccgacgaagcgaccaagcgggcgcggctcgcgctcgccgacgcaacgcgcatc
gtgatcgtcaacggcctcgccttgctcggcgtggacgcaccggagaaaatgtaa

DBGET integrated database retrieval system