KEGG   Treponema brennaborense: Trebr_0279Help
Entry
Trebr_0279        CDS       T01489                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
tbe  Treponema brennaborense
Pathway
tbe00440  Phosphonate and phosphinate metabolism
tbe01100  Metabolic pathways
tbe01120  Microbial metabolism in diverse environments
tbe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tbe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Trebr_0279
Enzymes [BR:tbe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Trebr_0279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase CTP_transf_like ComA CSN8_PSD8_EIF3K
Motif
Other DBs
NCBI-ProteinID: AEE15728
UniProt: F4LMG6
LinkDB All DBs
Position
complement(319193..320539)
Genome map
AA seq 448 aa AA seqDB search
MYNYFEHRSLFKESTLAKTVYLGLTGDIIHPGIINIIAEAAKYGEVTIGLLTDSAIVNHK
RLPYLTYEQRKKVVENIKGVSKIVPQKEWSYVPNLIKYKPDYIIHGDDWKTGSMSKVREE
VYETMKRQGGQVIEIPYTKGIDSSALVENAKGIGTTPEIRMKTLRRLISAKPIVRIMEAH
SGLSGLIIENTEIEKEDGMHRFDGMWSSSLTDSTDKGKPDIEAVDLTTRLQSLTDILECT
TKPIIFDGDTGGLTEHFVFTVRTLERNGVSAVIIEDKVGLKKNSLFGTEAKQELAPAEEF
CRKISEGKKAQVTKDFMIIARLEELIAGHTVDEALERADLYVKAGADGVMIHSKEKTGAD
IKEFCQRFREMYKNVPIVLVPTTYNQFQEKELKEWGANVIIYANHMLRAAYPAMVKCAET
ILRTERSLEVNDICMPIKQILELIPGTK
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtataattattttgaacacagatcactgttcaaggagtctacattggcaaaaacggtc
tatcttggtcttaccggcgatatcattcacccgggcattattaatattattgcggaagca
gctaaatacggagaggtcacgatcggccttcttaccgattcggctattgtcaatcacaaa
cggttaccgtatcttacgtatgaacaacgcaaaaaggtcgtagaaaatataaaaggcgtt
tcaaagatcgttccgcaaaaagaatggagttacgttccgaaccttatcaaatacaaaccc
gattacatcatacacggtgacgactggaaaacgggttccatgagtaaggtccgtgaagag
gtttatgaaacgatgaaacgacagggcggacaagtcattgaaattccctacacaaaggga
atcgattcttccgctctcgttgaaaatgccaaaggaatcggtacgacccccgaaatcaga
atgaaaacgctcagacggcttatttcggcaaaaccgattgtccgtattatggaagcacat
tcaggactttccggactgatcatcgaaaacacggaaattgaaaaagaagacggaatgcat
cggttcgacggcatgtggtcctcgtcacttaccgattctacggacaaaggcaaacccgac
attgaagctgtcgatttgacgacccgcctccaaagtcttaccgatattctcgaatgtacc
accaaacccatcatattcgacggagacaccggcggacttaccgaacacttcgtgtttacg
gtacggacgttggaacggaacggagtttcggcagtcattatcgaagataaagtcggtctc
aagaaaaattcattattcggaacggaggcaaaacaggaacttgcacctgcggaagaattc
tgccgtaaaataagcgaaggaaaaaaagctcaagttacgaaagactttatgattattgcc
cgactggaagaacttattgccggacacaccgtagatgaagcactcgaacgggccgatctg
tacgtcaaagccggagcggacggcgtcatgattcattcaaaagaaaaaacgggagcagac
ataaaggaattttgccaacgattccgtgaaatgtataaaaacgttcctatcgttctcgta
cccacaacgtacaatcagtttcaggagaaggaattaaaagagtggggtgcaaacgttatc
atatacgcaaaccacatgctgcgggcggcgtatcctgcaatggtaaaatgtgccgaaacc
attttacgtacggaacgctctttggaagtaaacgatatttgtatgccgatcaaacagatt
ctggaattgatcccgggtacgaaataa

DBGET integrated database retrieval system