KEGG   Treponema brennaborense: Trebr_1267Help
Entry
Trebr_1267        CDS       T01489                                 

Definition
(GenBank) ribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
tbe  Treponema brennaborense
Brite
KEGG Orthology (KO) [BR:tbe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tbe03016]
    Trebr_1267
Enzymes [BR:tbe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     Trebr_1267
Transfer RNA biogenesis [BR:tbe03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    Trebr_1267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB FAM24
Motif
Other DBs
NCBI-ProteinID: AEE16695
UniProt: F4LM16
LinkDB All DBs
Position
complement(1500609..1502528)
Genome map
AA seq 639 aa AA seqDB search
MLQKNSLVLYKTQPAVIIETGEKYTIEYCTALPTVGGKSASFAQQKVREKDITPFPGNVS
ALKTDLPAMLAQAGRTPPDISASVKAQLSDVYELLASDPETAEAAVSFSDIAALTGTQQA
SDVWSLYLALKTEPFFADASVPGSGDFSFTLRTAAEMQAITEKQNTKNREQEIRAAFIAR
LKQRKLQLPDDAQLMQDVEALALGKTDKSRTLKEAGFSETPEKAHKLLLDTGIWTAERNP
YPSRWGLSMQSAAEHLAHPPQEDRVTVSGVSYAIDNAWSTDPDDAIAFDGTHVWVHVADP
ASIVAPDSTIDTAARNRGTTLYIPEGAARMLAEESLEDYALGLAPESRALSFKILLDETG
AVADCDILKTIVKVERLTYVQADGKKETPELAPLYAIAKRNEERRIKAGAVSISLPEVHI
AAAGGDVSITPVMQTQASAVVREFMLLAGEAAARFAFKHAIPFPYVSQERPDIPKDLPEG
LAGQYRLRRCMRSRSIGITPLQHAGLGLGMYSQVTSPLRRYGDLVAHQQLRAFIGKKDLL
GKDELLERIAAGDAAASTAVKAERKSNLHWTLVYLSRNPEWTGQAVVVELKGKQAVCLIP
ELGQETVLNPSRPVQLNDTLTVRAGNISIPDLLVTFTAV
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgttgcagaaaaattcgctcgttttatataagacacagccggccgttatcatcgaaacc
ggtgaaaaatacactatagaatattgtaccgcgctgccgacggtcggcggaaagtccgcc
tcgtttgcacagcaaaaagtccgtgaaaaggacatcacgccgttccccggaaacgtatcc
gccttgaaaacagatctgcccgccatgttggcgcaagccggccggactcctcccgatatt
tccgcttccgtaaaagcgcagctttctgacgtgtacgaactgctcgcatccgatccggaa
actgctgaggcggcggtgtccttttcagatatcgccgcactgaccggaacgcagcaggcg
tccgacgtgtggagtttgtatctcgcgctgaaaacggaacctttttttgccgacgcaagc
gttccgggaagcggtgatttttcgtttacgctccgaaccgccgccgaaatgcaagccata
accgaaaaacagaatacgaaaaacagggaacaggaaattcgcgctgcgttcattgcccgt
ctgaaacagcggaaactgcagcttccggacgacgcacagctcatgcaggacgtggaagca
ctcgcactcggaaaaaccgataaatcccgtacgctgaaagaagcgggtttttccgaaacg
cccgaaaaagcgcataagctgctgctcgacaccggtatttggactgcggaacggaatccc
tatccgtcgcgctggggactttccatgcagtctgcggcggaacatcttgcgcatccgccg
caggaagatcgcgtaacggtttccggcgtttcgtatgcaatcgacaacgcctggagtacc
gatcccgacgacgcgatcgcgttcgacggaacgcacgtttgggtgcacgttgccgatccc
gcgtctatcgtggcacctgattctacgatagatacggccgcacggaaccgcggaacgacg
ctctacattcccgaaggcgccgcccgtatgctggcggaagaatcgttggaagattacgca
ctcggactggcacccgaatcgcgcgcgctttcgttcaaaattttgctcgatgaaaccggc
gccgtagccgactgcgatatactgaaaacgatcgtaaaagttgaacggctcacgtacgtt
caagccgatggaaaaaaagaaacgccggaactcgccccgctttatgcgatagcgaagcgg
aacgaagaacgccgtataaaagccggagcggtatccatttcactgcctgaagtacatatt
gcggcagccggcggcgacgtttcgatcacaccggtaatgcaaacgcaagcgtcagccgtc
gtacgggagttcatgctgctcgccggtgaagccgccgcgcggtttgcgttcaaacacgca
attccctttccgtacgtcagtcaggaacgtcccgatattcccaaagatctgccggaaggt
cttgccggtcaataccgcctgcgccgctgcatgagaagccgcagcatcggcataacgcct
ctccagcacgcgggactcggactcggcatgtacagtcaggtaacgagcccgctgcgccga
tacggagatttggtggcacatcagcagctgcgcgcctttatcggtaaaaaagacctgctg
ggcaaagacgaattgcttgaacggatagcggcaggcgacgcggcggcaagcaccgccgta
aaagcggagcgcaaaagtaatctgcactggacgctcgtgtacttgagccgtaatcccgaa
tggacgggacaagccgtcgtcgtagaactgaaaggcaaacaggcagtctgtcttattccc
gaactcggacaggaaaccgtactgaatccgtcccggccggtacaactgaacgacacgctt
accgtgcgcgccggaaacatctctattcccgatttgctcgttacgttcaccgccgtatag

DBGET integrated database retrieval system