KEGG   Thermobispora bispora: Tbis_1030Help
Entry
Tbis_1030         CDS       T01236                                 

Definition
(GenBank) aminotransferase class-III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
tbi  Thermobispora bispora
Pathway
tbi00250  Alanine, aspartate and glutamate metabolism
tbi00410  beta-Alanine metabolism
tbi00640  Propanoate metabolism
tbi00650  Butanoate metabolism
tbi01100  Metabolic pathways
tbi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Tbis_1030
   00650 Butanoate metabolism
    Tbis_1030
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tbis_1030
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Tbis_1030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tbi01007]
    Tbis_1030
Enzymes [BR:tbi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Tbis_1030
Amino acid related enzymes [BR:tbi01007]
 Aminotransferase (transaminase)
  Class III
   Tbis_1030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADG87753
UniProt: D6Y7T4
LinkDB All DBs
Position
1165740..1167035
Genome map
AA seq 431 aa AA seqDB search
MPDLLARHRAVMPKWMTLYYDEPIEIVSGKGCRVVDSTGKSYLDFFAGILTNMIGYDIPE
VKEAVERQLATGVVHTSTLYLIRGQVELAEKIARLSGIPNAKVFFTNSGTEANETALLLA
TYARGTDQVLAMRQSYHGRSFGAISVTSNRAWKNNSLSPLNVHFLHGADRHLPQFRGMSD
EEYIAACVADLRHVLATVAAGKVAALIAEPIQGVGGFTMAPDGLFAAYKEVLDEEGILFI
SDEVQTGWGRTGSAFFGIQNHGVTPDMITFAKGIGNGFAVGGVVARGDLMDAPHAIGLST
FGGNPIAMTAANATLDYVLDHDLQANAARMGDIIIPGLREAARRLPIVGDVRGKGLMFAI
DLVDPATREPSPPLAARFMEETKKRGLLVGKGGLYGHTVRMAPPLTLSEEEAREGLGIIV
AALEAINDEAR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccggacctgcttgcacgccatcgcgcggtcatgccgaaatggatgaccctgtactac
gacgagcccatcgagatcgtcagcggtaagggatgccgtgtcgtcgactcgacgggcaag
agctacctcgacttcttcgccggaatcctcaccaacatgatcgggtacgacatacccgag
gtgaaggaggccgttgagcggcagctcgccacgggtgtggtgcacacctcgacgctgtac
ctcatccgcggccaggtcgagctcgccgagaagatcgcccggctgtccggcattccgaac
gccaaggtcttcttcaccaactccggcacggaggccaacgagaccgcgctgctgctcgcc
acctacgcccggggcaccgaccaggtgctcgccatgcggcagagctaccacggccggtcg
ttcggcgccatcagcgtcacctccaaccgggcctggaagaacaactcgctctccccgctg
aacgtgcacttcctgcacggcgccgaccggcacctcccccagttccgcgggatgtcggac
gaggagtacatcgcggcctgcgtggcggacctgcgccacgtgctcgccaccgtggcggcc
ggcaaggtggccgcgctgatcgccgagccgatccagggcgtgggcggcttcaccatggcg
cccgacggcctgttcgccgcgtacaaggaggtcctcgacgaggagggcatcctcttcatc
tccgacgaggtccagaccggctggggccgtaccgggtcggcgttcttcgggatccagaac
cacggcgtcacgccggacatgatcaccttcgccaaggggatcgggaacggcttcgccgtg
ggcggggtggtggcccgcggcgacctgatggacgccccgcacgccatcggcctgtccacc
ttcggcggcaacccgatcgcgatgaccgcggcgaacgccaccctcgactacgtgctcgac
cacgacctgcaggcgaacgcggcccggatgggcgacatcatcatccccggcctgcgggag
gcggcgcggcggctgccgatcgtcggcgacgtccgcggcaagggcctgatgttcgcgatc
gacctggtcgacccggccacccgcgagccctcgccgccgctggccgcccggttcatggag
gagaccaagaagcgcgggctgctcgtcggcaagggcggcctctacggccacacggtgcgg
atggccccgccgctcaccctcagcgaggaagaggcccgggagggcctgggcatcatcgtc
gccgcgctggaggccatcaacgatgaagcacgttag

DBGET integrated database retrieval system