KEGG   Thermobispora bispora: Tbis_1177
Entry
Tbis_1177         CDS       T01236                                 

Definition
(GenBank) undecaprenyl diphosphate synthase
  KO
K21273  trans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.88]
Organism
tbi  Thermobispora bispora
Pathway
tbi00900  Terpenoid backbone biosynthesis
tbi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tbi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tbis_1177
Enzymes [BR:tbi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.88  trans,polycis-polyprenyl diphosphate synthase [(2Z,6E)-farnesyl diphosphate specific]
     Tbis_1177
SSDB
Motif
Pfam: Prenyltransf Terminase_4
Other DBs
NCBI-ProteinID: ADG87899
UniProt: D6Y8K2
LinkDB
Position
1339806..1340591
AA seq 261 aa
MVRPPAPHPSGARPPEIPRELLPRHVAIIMDGNGRWAKARGLPRTEGHKRGEYSLFDVIQ
GAIELGIPYLSAFAFSTENWKRSPEEVRFLMGFNRDVIRRRRDELHEMGVRVRWAGRRTR
LWRSVIKELEDAERLTRNNTTLTLQFCVNYGGRAEITDAAARLARDVAAGRVNPDKITEK
VFARYLDEPDIPDVDLFIRSSGEQRVSNFLLWQSAYAEMVFLDRLWPDFDRRDLWEACRI
FAKRERRYGGAEPNEVRPASG
NT seq 786 nt   +upstreamnt  +downstreamnt
atggtccgtccacccgctccgcatccctcgggggcgaggccgcccgagatcccccgggag
ctgctgccccggcacgtcgcgatcatcatggatggcaatggccgctgggccaaggcccgc
gggctgccccgcaccgagggccacaagagaggggagtactccctcttcgatgtcatccag
ggcgccatcgagctcggcatcccgtacctgtcggcgttcgcgttctccacggagaactgg
aagcgctccccggaggaggtccgcttcctcatgggcttcaaccgggacgtgatccgccgc
cgccgcgacgagctccacgagatgggggtacgggtccggtgggccgggcggcggacccgg
ctctggcggagcgtcatcaaggagctcgaggacgcggaacggctcacccggaacaacacc
acgctgaccctgcagttctgcgtgaactacggtggccgggccgagatcaccgacgccgcc
gcgcggctcgcccgggacgtcgccgccgggcgggtcaacccggacaagatcaccgagaag
gtcttcgcccgttacctggacgagccggacatcccggatgtggacctgttcatccggtcg
tccggtgagcagcgcgtttcgaacttcctgctctggcagtccgcctacgcggagatggtc
ttcctcgaccggctctggcccgacttcgaccgccgggacctgtgggaggcctgccggatc
ttcgccaagcgcgagcgccggtacggcggggccgagccgaacgaggtccgccccgcctca
ggctga

DBGET integrated database retrieval system