KEGG   Thermobispora bispora: Tbis_1940Help
Entry
Tbis_1940         CDS       T01236                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
tbi  Thermobispora bispora
Pathway
tbi00061  Fatty acid biosynthesis
tbi00780  Biotin metabolism
tbi01100  Metabolic pathways
tbi01130  Biosynthesis of antibiotics
tbi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tbi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Tbis_1940
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Tbis_1940
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Tbis_1940
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tbi01004]
    Tbis_1940
Enzymes [BR:tbi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Tbis_1940
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Tbis_1940
Lipid biosynthesis proteins [BR:tbi01004]
 Fatty acid synthase
  Component type
   Tbis_1940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ADG88652
UniProt: D6Y1P6
LinkDB All DBs
Position
complement(2248656..2249420)
Genome map
AA seq 254 aa AA seqDB search
MGLLEGKRLLITGVLTESSIAFNVARLAQEEGARVVLTGYGRLSLVERIAKRLPEPPPVI
ELDVQNNEHLDTLADRVGEHLEGLDGVVHSIGFAPQSCLGGNFLNTPWEDVATALHVSTF
SFKSLAVACLPLMKEGGAIVGLDFDASKAWPVYDWMGVAKAGLESCARYLARDLGKHGIR
VNLVSAGPLRTMAARSIPGFQEFEESWPARAPLGWDLNDTTPAAKACVALLSDWFPATTG
EIIHVDGGVHAMGA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgggtttgctggaaggcaagaggctgctgatcaccggcgtcctcaccgagtcgtcgatc
gccttcaacgtggcgcggctcgcccaggaggaaggcgcccgcgtcgtgctcaccggttac
ggccggctgagcctggtcgagcgcatcgccaagcggctgcccgagccgccgccggtgatc
gagctggacgtgcagaacaacgagcacctcgacacgctcgccgaccgggtcggcgagcac
ctggagggactcgacggcgtcgtccactccatcggcttcgccccccagtcctgcctcggc
ggcaacttcctcaacacgccgtgggaggacgtggcgacggcgctccacgtctcgacgttc
tcgttcaagtcgctcgccgtcgcctgcctgccgctcatgaaggaggggggcgccatcgtc
ggcctggacttcgacgcgagcaaggcctggcccgtctacgactggatgggcgtggccaag
gccggcctggagtcgtgcgcccggtacctcgcccgggacctcgggaagcacggcatccgg
gtgaacctcgtctccgccgggccgctgcgcaccatggcggcgcggagcatccccggcttc
caggagttcgaggagagctggccggcgcgggcgccgctcggctgggacctgaacgacacc
accccggccgcaaaggcgtgcgtcgcgctcctgtccgattggttccccgccaccacaggt
gagatcatccacgtggacggcggggtgcacgccatgggcgcctga

DBGET integrated database retrieval system