KEGG   Thermobispora bispora: Tbis_2256Help
Entry
Tbis_2256         CDS       T01236                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
tbi  Thermobispora bispora
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ADG88966
UniProt: D6Y391
LinkDB All DBs
Position
complement(2620873..2621931)
Genome map
AA seq 352 aa AA seqDB search
MRLPVQPPIAPMLAKAVARPPAQDGTLYYEPKWDGFRCIVFRDGDEVHLGSRNERPFTRY
FPEVVAAVRAELPPRCVVDGEIVVRSGPVLDFDALQQRIHPAASRVALLAERTPASFIAF
DLLAIGDENLMGAPFSARRARLEQAAARAGASVLLTPVTRDERVAAEWFDLFEGAGLDGL
VVKPGGLPYLPGKRVMLKVKHERTADCVVAGYREHASGPVVGSLLLGLYGGDGRLHHVGV
ASAFPMRQREELVARLAPYRTELSGHPWAGEAGATGQRVPGGVSRWTGKKDMSFIPLRPE
LVAEVAYDHMEGDRFRHTARFRRWRPDRDPASCTYAQLERPVAYDLDDILAR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaggcttccggtccagccgccgatcgcgcccatgctcgccaaggcggtcgcccggccg
cccgcccaggacggcacgctctactacgagccgaagtgggacgggttccggtgcatcgtg
ttccgggacggcgacgaggtccacctgggcagccggaacgagcggccgttcacccgctac
ttcccggaggtggtggccgcggtccgggccgagctgcccccgcgctgcgtcgtggacggg
gagatcgtggtgcgttccggtccggtgctcgacttcgacgcgctccagcagcgcatccac
cccgccgcctcccgggtggcgctcctcgccgagcgcacgcccgcctcgttcatcgccttc
gacctgctcgcgatcggcgacgagaacctgatgggcgcgccgttctcggcccggcgcgcc
cgcctggagcaggccgccgcccgggccggcgcctcggtgctgctcaccccggtgacccgg
gacgagcgggtcgccgccgagtggttcgacctgttcgagggcgccgggctcgacggcctc
gtggtcaagcccgggggcctgccgtacctgccgggcaagcgggtgatgctcaaggtgaag
cacgagcggacggccgactgcgtggtcgccggctaccgggagcacgcctcgggcccggtc
gtcggctccctcctgctcggcctgtacggcggcgacggccgcctccaccacgtcggggtg
gcctccgccttcccgatgcggcagcgggaggagctcgtggcccggctcgcgccgtaccgg
acggagctgagcggccacccgtgggcgggggaggcgggggcgaccgggcagcgcgtcccg
ggcggcgtctcccggtggacggggaagaaggacatgtcgttcatcccgctccggcccgag
ctggtggccgaggtcgcctacgaccacatggagggcgaccggttccggcacaccgcccgg
ttccgccgctggcggcccgaccgcgaccccgcctcctgcacgtacgcccagctcgagcgg
ccggtcgcctacgacctcgacgacatcctcgcccggtag

DBGET integrated database retrieval system