KEGG   Thermobispora bispora: Tbis_2338Help
Entry
Tbis_2338         CDS       T01236                                 

Definition
(GenBank) DNA polymerase LigD, ligase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
tbi  Thermobispora bispora
Pathway
tbi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tbi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Tbis_2338
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tbi03400]
    Tbis_2338
Enzymes [BR:tbi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Tbis_2338
DNA repair and recombination proteins [BR:tbi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Tbis_2338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ADG89047
UniProt: D6Y3U5
LinkDB All DBs
Position
complement(2721213..2722178)
Genome map
AA seq 321 aa AA seqDB search
MGRLPAYAPMLARPGALPEPDEAYAHEMKWDGVRALAYIEDGRLRLVSRNGLDITAAYPE
THGLAGAVGGHDLVLDGEIVAFDRQGRPSFEALQPRIHQRDPLRVARLSVTSPVTYLLFD
LLHIDATPVIGLPYAERRALLEEIVRGGERWDVPPCYHGAGPRAVAESRRLGLEGVVAKR
LASPYRPGRRSPDWVKVKNFRTQDVVVCGWKPGGGRRSGTIGSLLVGVQTADGLRYAGHV
GTGFTEAALRDLAQRLAPLERRGHPFAEEPPREEVRDARWVEPVLVGEVRYTEWTGEGRL
RHPSWRGLRADKRPDEVVRED
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgggccggttgcccgcctacgcgcccatgctcgcgcggccgggtgcgctgccggagccg
gacgaggcgtacgcccacgagatgaagtgggacggcgtccgcgcgctcgcctacatcgag
gacggccggcttcggctggtctcgcgcaacgggctcgacatcaccgccgcctacccggag
acgcacggcctcgccggcgcggtgggcgggcacgacctggtgctcgacggggagatcgtc
gccttcgaccggcaagggaggccgtcgttcgaggcgctgcagccgaggatccaccagcgg
gacccgctgcgggtcgcccggctctcggtcacctcacccgtgacgtacctgctcttcgac
ctgctccacatcgacgccacgccggtgatcggcctgccgtacgcggagcgccgggcgctg
ctggaggagatcgtgcggggcggggagcgctgggacgtgcccccgtgctaccacggcgcg
ggcccgcgcgcggtcgcggagtcccgccggctcggcctggagggggtggtggccaagcgg
ctcgcctcgccgtaccggccgggccggcgctcgcccgactgggtgaaggtgaagaacttc
cgcacccaggacgtggtcgtgtgcgggtggaagccgggcggcggccggcggagcgggacg
atcggctcgctgctcgtcggggtccagacggccgacggcctgcggtacgcgggccacgtc
ggcacggggttcaccgaggccgcgctgcgcgacctggcgcagcggctggcgccgctcgag
cggcgcggccaccccttcgccgaggaaccgccgcgggaggaggtgcgcgacgcccgctgg
gtcgagccggtgctggtcggcgaggtccggtacacggagtggaccggtgagggcaggctg
cggcacccctcctggcgcgggctccgggcggacaagcgcccggacgaggtggtccgggag
gactga

DBGET integrated database retrieval system