KEGG   Thermobispora bispora: Tbis_2903Help
Entry
Tbis_2903         CDS       T01236                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
tbi  Thermobispora bispora
Brite
KEGG Orthology (KO) [BR:tbi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Tbis_2903
Enzymes [BR:tbi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Tbis_2903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni DUF2937
Motif
Other DBs
NCBI-ProteinID: ADG89602
UniProt: D6Y6W1
LinkDB All DBs
Position
3414683..3415087
Genome map
AA seq 134 aa AA seqDB search
MLARLLRPRHEVSAHCDLPCGVYDPAQARIEAESIKAIIKKYAENEDPVFRTRALLIKEQ
RAELVKHHLWVLWTDYFKPQHLEKYPQLHQLFWEATKLAGAAGAKGTVDPAIADQLLAKI
EEISKIFWETKQAA
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcacgactgctgcgacccaggcacgaggtctccgcgcactgtgacctgccctgc
ggcgtgtacgacccggcgcaggcccgcatcgaggccgagtcgatcaaggcgatcatcaag
aagtacgccgagaacgaggacccggtcttccggacccgtgccctgctcatcaaggagcag
cgggcggagctggtgaagcaccacctgtgggtgctctggaccgactacttcaagccgcag
cacctggagaagtacccccagctgcaccagctcttctgggaggcgaccaagctcgccggc
gccgccggcgcgaagggcacggtggaccccgccatcgccgaccagctcctcgccaagatc
gaggagatttccaagatcttctgggagaccaagcaggccgcctga

DBGET integrated database retrieval system