KEGG   Tetrapisispora blattae: TBLA_0A02030Help
Entry
TBLA_0A02030      CDS       T02489                                 

Gene name
TBLA0A02030
Definition
(RefSeq) hypothetical protein
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
tbl  Tetrapisispora blattae
Pathway
tbl04113  Meiosis - yeast
tbl04138  Autophagy - yeast
tbl04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    TBLA_0A02030 (TBLA0A02030)
  09143 Cell growth and death
   04113 Meiosis - yeast
    TBLA_0A02030 (TBLA0A02030)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    TBLA_0A02030 (TBLA0A02030)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tbl01001]
    TBLA_0A02030 (TBLA0A02030)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tbl03019]
    TBLA_0A02030 (TBLA0A02030)
   03036 Chromosome and associated proteins [BR:tbl03036]
    TBLA_0A02030 (TBLA0A02030)
Enzymes [BR:tbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     TBLA_0A02030 (TBLA0A02030)
Protein kinases [BR:tbl01001]
 Serine/threonine kinases: AGC group
  PKA family
   TBLA_0A02030 (TBLA0A02030)
Messenger RNA biogenesis [BR:tbl03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     TBLA_0A02030 (TBLA0A02030)
Chromosome and associated proteins [BR:tbl03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    TBLA_0A02030 (TBLA0A02030)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 14493136
NCBI-ProteinID: XP_004177523
UniProt: I2GV52
LinkDB All DBs
Position
1:complement(491365..492576)
Genome map
AA seq 403 aa AA seqDB search
MDMPINYQDYQHQHQQPHHQQQQQKAFIRQQQMGHTTVDSSNNDQAGNIAMASDLKAAIQ
RNVNIDMDSNNNEVVHKHQRSTVTKGKYGLQDFQIMRTLGTGSFGRVHLVRSVHNGRYYA
IKVLKKQQIIKMKQIEHTNDERRMLKLVEHPFIIRLWGTFQDSRNLFMVMDYIEGGELFS
LLRKSQRFPNPVAKFYAAEVVLALEYLHANNIIYRDLKPENILLDRNGHIKVADFGFAKE
VSSVTWTLCGTPDYIAPEVIATKPYNKSVDWWSLGVLIYEMLAGYTPFYDVTPMKTYEKI
LQGKINFPQGFHPDVIDLLTRLITSDLTKRLGNLQNGSRDVKNHPWFSEVIWEKLLARDI
ETPYEPPITAGVGDTSLFDQYPEEHFDYGIQSDDPYAQYFIDF
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggatatgccaataaattatcaagattatcaacatcagcatcaacaaccccatcatcaa
cagcagcagcagaaggcttttattcggcaacaacaaatgggtcatactacagtcgattcc
agtaataatgatcaagcaggtaatattgctatggcttctgatttgaaggcagccattcaa
aggaatgtcaatatcgatatggatagtaacaataatgaagtagtacacaagcatcaaaga
tcaacagtcacaaagggtaagtacggtcttcaagattttcaaataatgcgtactttgggt
actggttcgttcggtagagttcatctagtcagatctgttcataatggtaggtactatgcc
atcaaagtattgaaaaagcaacagatcatcaagatgaaacaaatagagcatacgaatgat
gaaagaagaatgttgaaattggtagagcatccctttattatcagattatggggtactttc
caagattcaaggaatttgtttatggttatggattatattgaaggtggtgaattgttttct
ctattaagaaaatctcaaagatttccaaatcccgtagcaaaattttacgcagcagaagtg
gttcttgcattagaatatttacatgctaataatatcatttatagggatttaaaaccagaa
aatatcttattagatcgtaatggtcatatcaaagttgctgattttgggtttgcaaaagaa
gtatcttctgtaacctggaccttatgtggtacgccagattatattgccccagaagttatt
gcaacaaaaccttataacaaatctgttgattggtggtctctaggggtattaatttacgaa
atgttggcaggttatacacccttttatgatgtgacaccaatgaagacatatgaaaagatt
ttacaaggtaaaattaatttcccacagggattccaccctgatgtcattgatcttttaact
agattgatcacttcagatttaacaaaaagattggggaatttgcaaaatggttcaagagat
gtgaaaaatcatccttggtttagtgaagtcatttgggaaaaattattagctagagatatt
gaaacaccttatgaaccaccaattactgcaggtgttggtgatacttcattatttgatcaa
tatccagaagaacatttcgattatggtatccaatcagatgatccttatgctcaatatttc
attgatttttag

DBGET integrated database retrieval system