KEGG   Tetrapisispora blattae: TBLA_0A03860Help
Entry
TBLA_0A03860      CDS       T02489                                 

Gene name
TBLA0A03860
Definition
(RefSeq) hypothetical protein
  KO
K19589  release factor glutamine methyltransferase [EC:2.1.1.297]
Organism
tbl  Tetrapisispora blattae
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:tbl03012]
    TBLA_0A03860 (TBLA0A03860)
Enzymes [BR:tbl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.297  peptide chain release factor N5-glutamine methyltransferase
     TBLA_0A03860 (TBLA0A03860)
Translation factors [BR:tbl03012]
 Eukaryotic type
  Release factors
   TBLA_0A03860 (TBLA0A03860)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS PrmA Methyltransf_25 Methyltransf_23 UPF0020
Motif
Other DBs
NCBI-GeneID: 14492806
NCBI-ProteinID: XP_004177703
UniProt: I2GVN2
LinkDB All DBs
Position
1:965727..966398
Genome map
AA seq 223 aa AA seqDB search
MLPTPYTKFDYDKVYEPSEDSFLLLDCLESELKFLDEKLKGKLSVVCEIGPGSGIVTTFM
IQNSIPSLNSSIYLAVDINPWALESTIDTAARNNCKGRYLDTIQCNLTDSLKANEVDLLV
FNPPYVPAEEVPQIPESKGEIDNWLDLALLGGKDGMVITNKVLENLDSILSSNGVAYILF
CARNKPEVITAEMKKTGNWKIELVETRKAGWEVLSVYRFERQH
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctactccatatactaaattcgattatgataaggtgtacgagccttctgaagat
agctttcttttgctagactgtctggagtctgaattaaaattcttggatgagaaactaaaa
ggtaagttatctgttgtttgtgaaataggccctggttcaggaattgtaaccacctttatg
atacaaaattcaatcccctctctaaattcatctatttatttagcagtggatattaatcct
tgggctcttgaatctactatagataccgctgctaggaacaactgcaaaggtcgttatttg
gatactattcaatgtaaccttactgactctctaaaagccaacgaagtcgatttactagta
tttaatccaccatatgtacccgctgaagaagtaccacagataccagaatctaaaggtgaa
attgataactggctggacttagcactgttaggtggaaaggatggaatggtaataacaaat
aaagtactagaaaatttggattcaatactatcaagtaatggagttgcatatattctattt
tgtgcaagaaataaaccagaagtcattactgcagaaatgaagaaaactggcaattggaaa
atagaattagtagaaactcgtaaagctggttgggaagtattaagtgtatatcgttttgaa
agacaacactaa

DBGET integrated database retrieval system