KEGG   Tetrapisispora blattae: TBLA_0A03870Help
Entry
TBLA_0A03870      CDS       T02489                                 

Gene name
TBLA0A03870
Definition
(RefSeq) hypothetical protein
Organism
tbl  Tetrapisispora blattae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dopey_N SCAPER_N
Motif
Other DBs
NCBI-GeneID: 14492818
NCBI-ProteinID: XP_004177704
UniProt: I2GVN3
LinkDB All DBs
Position
1:complement(966525..971576)
Genome map
AA seq 1683 aa AA seqDB search
MSLPLKSLTIDSNSKQLDSKQKKFHSNVQRALEHFDSVTEWADYIASLGKLLKALQSWKP
QFNNVKYYVPSPYQVSRRLTSSLSPNLPAGVHQKTLEVYTFIFTKIGQDTLAKECNIWVP
GILPLMSYASMSVKSHLIELYDSHLVQLPKETLTLLIRPLLASLLPGIDDESSEFQPLTM
NLIDLLKKINNDSLFWQTCFLIMIKNKGRRLGGLVWLTKRFPSLNAVPHLLAELKKKNNE
GVPEDISKEEKTFSVLLPESKDLVTPDTTLLIRCLVSSLTEGNDLLIKRGVLDLLLQRLH
LDSPILQNISTREDVKLLIMTTLKTTLSKDMSLNRRVWNWLLGSSTSTGRSFSEKERNKT
SEDIESNEGTSDFFSMFGLSIVIEGLKELVNSEETVNIAFNICLAVMDRWEIGSAIIPEM
FIPLLLGSQRFSENQQILKVAGTFFDAVETNIIWGKVFQWFMSTKDFEFLNFILTRFNIS
TDEEIIVRHLPMILLALLSISNISDTTIEFKKGASNRYSICQQLLDSIPERAYLPLTHST
LKFSDKTTNNNTLEKIMDYYISVSDPSKIQESEKLIELSLPFSTENLSFLTVKAIHTIVL
ENLKNSSRVYESCNIFIRILDKIPTMENNKKEIAEDWSTDQLLNGVSEALTSATIEGQAV
FGILSLYSNYLAHRIDLISSTKLLRSITVALWPYIVGPHKQLKAVKGMQALIRNIPIVYV
EAALAHAFVQESDISKQLKAIELLWSHFDNDSGILAKPLQLILDELFDQNNPHYLYVSKW
LLNLKQSKTINRLFDLLVNQLIKFDFWTRDSLVGEDDMDEFTYRIQSLLNVLVTNEGQII
EVFSTELSISPTLSIWNKEDTSTFKNHTLLIILKFLEMKNNNNARSIRSVLLLLDHLLNG
TEMNFRVIVISLLQMSSNYVSLGDIDSESMAVSLINIVSKVLRLSHVKGIKLDIFNDNTT
HLKYIDYLVTSSATMDTPLILASYVKLLSESVVYFEESIFRMILPLTASMVNCLQKLFEA
EKVSGGNYQSIILLFNGLEELLDVAHARLLADQRDGYLATSGSRGSDFLQSVVSNVFSTD
NSQLLTKIQGERDVVIQSFKQVIDSCIDVWCWIHSTFGNDSRAVSETESHTSYKLKFRTK
SLLEKLFLAEPLEVLEGIIHGHQNETAVVLIRALDGNRPKLTVPYFLYSIVVRYNKSSTI
KFNNFTTSAMSGNRNTRFEPTLLNKISGQKILVFLFDYIDTLENASVEDFYNEFIIFIKE
VINNYSNYNPVATKILKLFALVSEKVYKTSFAEQKTVNREISENFLKYLPTALSDLQDKT
IPQAEKYDDLIYLLSQAQYVSNDSVGSDKYNGILSSIVSQCIIPFIRGKNEEVIPTHVLH
MCIELSKTAERVKIWKSLINELFEDDKKFFTLAKLEEWRILFADWCQYPDNKSRILNDLL
LLIDSKNNSVTPVLLNFNSWNVSELENKCKNITRIAYLVTICPDDFFILQFQSLINYTCQ
YLVSKEVVLRSKCWILLRALLLKFSISHFNDYWSSIVYCLQTNLQEFYEALQLQGSIDHT
SVFQTCKSLDLILAMNVEDFDATNEWLFIIDTINCLTKTEPYMALSDEICETKPFKGFKP
TDNSLHLNEYLPLLSNIHSIKTYSELGSFFKNITINSYNTMFQLKSLDLSKCKTDLLDDM
LQE
NT seq 5052 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaccattaaagtctttgacaattgattcaaacagcaagcaattagattccaag
caaaagaaatttcattcgaatgtccaaagagctttggagcattttgattctgttacagag
tgggcagattacattgcaagcttgggaaagttattaaaagctcttcaaagttggaaacca
caatttaataatgtaaaatattatgttccatctccttatcaagttagtagacgattaaca
tcctccttatctccaaatttaccagcaggtgtccatcagaaaacattagaagtatatact
tttatttttaccaaaattggccaagatactttagcaaaagaatgtaatatatgggtgcct
ggtattctccctttaatgtcatacgcgtcaatgtcagtgaaatctcatttgatagagtta
tatgattcacatttggttcaactacctaaagaaacattaacgcttttgattagaccttta
ttagcaagtttattacctggtattgatgacgaaagtagtgaatttcaaccattaactatg
aatttaatagatctattaaagaaaattaataatgattcattattttggcaaacttgcttc
ttaattatgataaagaataaaggtcgtagacttggtgggttagtttggcttaccaaaaga
tttccatctttgaacgctgtgcctcacttacttgctgaactgaagaagaaaaataatgaa
ggtgttccagaagatataagcaaagaggaaaagacattttccgttttactaccagaatct
aaagaccttgttaccccagatacgaccttattgatccgttgtttggtttcttcattaact
gaaggtaatgatttactaattaaaagaggtgttttggacttgttattacaaagactgcat
ttagattctccaatcttacaaaatatatcaactagagaagatgtgaaactcctgattatg
acaactttgaaaactacattaagcaaagatatgtcactaaatagaagagtttggaattgg
ctattggggtcatcaacttctacaggaaggtcattctcagaaaaggaaagaaataagaca
tctgaagacattgaatcaaatgaaggtacatccgactttttttctatgtttggactgagt
attgttatagaaggcttgaaagaattagttaattcagaagaaactgtaaatattgcattt
aatatttgcttagcggttatggatagatgggaaattggatcagcaataattcctgaaatg
ttcattccacttcttttaggctctcaacgtttctctgaaaatcagcaaatattaaaagtc
gctggaacgttttttgatgctgttgaaaccaatataatatggggtaaagttttccaatgg
tttatgagtacaaaagacttcgaatttttgaattttatccttactagatttaacatttct
acagatgaagaaattattgttcgtcatttaccaatgatattactagccttgttatcaata
tcaaatatatcagatactacaatagaatttaaaaagggagcttctaaccgatattcaatc
tgtcagcaattattagattcaattccagaaagggcatatttacctttaactcattctact
ttaaaattttctgataaaactaccaataataatacattagaaaaaattatggattattat
ataagtgtttctgatccatcaaaaattcaggaatctgagaagctaatagagttatcctta
ccattctcaacggagaatctatcttttttgacagtaaaggccatccatactatagttctt
gagaacctaaaaaattcatccagggtatatgagtcgtgtaatatttttattagaatcctg
gataaaattccaacaatggaaaataacaaaaaggaaattgctgaagattggtcaacagat
caattattaaatggggtttcagaagcactaacttctgcaactatcgaaggtcaagcagtt
tttggtatactttcgttgtatagcaattatttggctcatagaatagatttaatttcttcc
acaaagctattaaggtctattacagttgctttatggccctatatagttggacctcataaa
caactaaaggcagttaaaggaatgcaggctttaattcgtaatataccaatagtttatgtc
gaagctgctttagctcatgcatttgttcaagaatcagatatatcaaaacaattaaaggct
attgaactactttggtcacattttgataacgatagtggtattcttgccaaaccacttcaa
ttaatattagatgaacttttcgatcagaataacccccattacttatatgtttctaaatgg
ctgcttaatctaaaacaatctaaaactattaatagattattcgatcttttggtaaatcaa
ttaattaaattcgacttttggacaagagatagtttggtaggggaagatgatatggatgaa
tttacatatcgaattcaaagtttattaaatgtattggtaacaaatgaaggccaaattatc
gaagtattttctactgaattatccatttctccaacattatccatctggaataaagaagat
acttctacttttaaaaaccatactttattaataattctaaaatttttagaaatgaaaaac
aataacaatgctagaagtattagaagtgtattgttgctattagaccatctgctgaatggt
actgaaatgaattttagagttattgtgatctcactattacaaatgtcatccaattatgtg
tctcttggtgatatagattcagaatcaatggcagtttctttaataaatattgtttccaaa
gtgttacgcctttcccatgttaagggtatcaaattagatatatttaatgataataccaca
catttaaaatacattgattatctagttacgagtagcgctacgatggataccccattgata
cttgcatcatatgtgaaattactatcagaaagtgttgtatattttgaagagtctatattt
agaatgatccttccactaactgcgtcaatggtaaattgtttacaaaaactttttgaagca
gaaaaggttagtggtggaaactatcagtcaattatccttctttttaatggtttagaagaa
ttgcttgatgttgctcatgcaagattgttagcagatcaacgagatggttatctagcaacc
agtggttcaaggggtagtgattttcttcaatcagttgtttccaatgttttttcgacagat
aactctcagctattaactaaaatccagggtgagcgtgatgtggttattcaatcatttaaa
caagttattgattcttgcattgatgtttggtgttggattcattcaacttttggcaacgat
agtcgtgctgtaagtgaaacggaaagtcatacttcctataaattaaaattcagaacaaaa
agtttattggaaaaattatttttagcagaacctcttgaagttcttgaaggaattattcat
ggacatcaaaatgaaaccgcagttgttttaattcgcgccttggatggtaatagacccaaa
ttaacagttccatatttcttatacagtattgttgtgagatataacaagagttccactatt
aaatttaataattttacgacaagtgctatgtctggaaacaggaatacccgtttcgaacct
acactgttaaataaaatttcaggccaaaaaattctagtatttttatttgattatattgat
actttagagaatgcaagtgttgaagatttttataacgaatttattatattcattaaagag
gtgattaataattatagcaattacaatccagtagcaacaaagatattgaaattatttgct
ctagtttcagaaaaagtttacaaaacttcttttgctgaacaaaaaactgttaatagagaa
atatctgaaaatttcttaaaatacttaccaactgctttgtctgatctacaggataagaca
ataccccaagctgagaaatacgatgatttaatttatttgctttctcaagctcagtatgtt
tctaacgattctgttggaagtgataagtataatggcatactaagtagtattgtatcacag
tgcataataccgttcattagagggaaaaatgaagaagttatcccgacacatgttctacat
atgtgcattgaactatccaaaactgcagaaagagtaaaaatttggaaaagtttaataaat
gaattatttgaagatgacaaaaaattcttcacattagcaaaattagaagaatggaggata
ttatttgcagattggtgccagtatcctgacaataaatctcgtatattaaatgacttactt
ttattgattgattctaaaaacaatagtgtcacccctgttttattgaattttaattcatgg
aacgtttctgaactggaaaataaatgtaagaatattaccagaattgcatatctagtcaca
atttgccctgatgatttttttattttacaatttcaatctttaattaattatacttgccag
tatttagtttctaaagaagttgtattaaggtctaagtgctggattttactaagagcatta
ttattaaaattttcaatttctcattttaatgattattggtcatctattgtttattgtcta
caaactaatttacaagaattttatgaagctcttcaattgcaaggttcaatagatcataca
tccgtatttcaaacctgtaaatctttagatctaattttagctatgaatgtagaggatttc
gatgcaacaaatgaatggctatttattattgataccataaattgtctaaccaagactgaa
ccatatatggccctctcagatgagatatgcgaaactaaaccatttaaaggatttaaacca
acagataattcactacatttgaatgagtacttacctttactatctaatattcattcaatt
aaaacatattctgaattaggatcattttttaaaaatatcacaataaacagttacaatact
atgttccaattgaagagcctcgatttatcaaaatgtaaaactgatctacttgatgatatg
ttacaagaataa

DBGET integrated database retrieval system