KEGG   Tetrapisispora blattae: TBLA_0A03890Help
Entry
TBLA_0A03890      CDS       T02489                                 

Gene name
TBLA0A03890
Definition
(RefSeq) hypothetical protein
  KO
K13341  peroxin-7
Organism
tbl  Tetrapisispora blattae
Pathway
tbl04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    TBLA_0A03890 (TBLA0A03890)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40
Motif
Other DBs
NCBI-GeneID: 14492815
NCBI-ProteinID: XP_004177706
UniProt: I2GVN5
LinkDB All DBs
Position
1:complement(973249..974337)
Genome map
AA seq 362 aa AA seqDB search
MLEFNLNGFSGYGVQYSPFFDSKIAVVSGANYGLSGQGKLSILNLTGNRQMQESASVITN
DCLFDLAWSEINPTQVLVAQGDGTLTLFDLTNKLQQIQIYKEHYSEVFSCNWNMLTRRTF
ISGSWDGKVKIWDCARSESVLTLRNNRSLGHTGEHIETKALQRNSKNKDCIYQALFSPHD
PNMAMCCSGNSYLTFFDLRQPNQQNSILAHSGLETLSCDYNKYRSYIVASAGVDKAIRIW
DLRMIKNKPHNMFADISSYNCTNEVVNAHELAIRKILWSPHHSNYFLTTSYDLTCRVWQD
LSHDGTRQVWKTNSTEPGKGCRYKFNKHTEFVLGADWSLWGQPGFVASTAWDGKVFIWNA
FE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgttagaattcaatttaaatggattcagtgggtacggtgtacaatattctcccttcttt
gactcaaaaattgcagtggtttcaggtgcaaattatggtctatcaggtcaagggaaactg
tctattcttaatttaacaggaaatagacagatgcaagaaagtgcatcagtgattactaat
gattgtttatttgatttagcttggagtgaaattaatcccactcaggtattggttgcacag
ggtgatggtactcttactttattcgaccttacaaataaacttcaacaaattcagatatat
aaggaacattatagtgaagtattttcctgtaattggaatatgttgactagaagaaccttt
atatcaggatcatgggatgggaaagtgaaaatatgggattgtgcaagaagtgaaagtgtt
cttaccttgcgtaataaccgatctttaggtcatactggcgaacatatcgaaacaaaagct
ttacaaagaaattcaaagaataaagattgcatataccaagccttattttccccacatgat
cctaatatggccatgtgttgttcaggaaattcttatttaacattttttgatcttcgacag
cctaatcaacagaatagtattcttgctcattcaggtcttgagacattatcctgtgattat
aataaatatagaagttacatagtggcttccgccggcgtcgacaaggctataaggatatgg
gaccttcgaatgattaaaaacaagccacataatatgtttgcagatattagttcttataat
tgtactaatgaagtcgtaaacgctcatgagttagcaattagaaagatattatggtcacca
catcattccaattattttttaacaacttcatacgatcttacgtgccgcgtatggcaagat
cttagtcatgatggtactagacaagtttggaaaacaaatagtacggaaccagggaaagga
tgccgttataaatttaataaacatactgaatttgttcttggtgctgattggagtctttgg
ggccaacctgggtttgtagcttcgacagcttgggatgggaaagttttcatttggaatgcc
tttgagtag

DBGET integrated database retrieval system