KEGG   Tetrapisispora blattae: TBLA_0A08010Help
Entry
TBLA_0A08010      CDS       T02489                                 

Gene name
TBLA0A08010
Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
tbl  Tetrapisispora blattae
Pathway
tbl00020  Citrate cycle (TCA cycle)
tbl00480  Glutathione metabolism
tbl01100  Metabolic pathways
tbl01110  Biosynthesis of secondary metabolites
tbl01130  Biosynthesis of antibiotics
tbl01200  Carbon metabolism
tbl01210  2-Oxocarboxylic acid metabolism
tbl01230  Biosynthesis of amino acids
tbl04146  Peroxisome
Module
tbl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tbl_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TBLA_0A08010 (TBLA0A08010)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TBLA_0A08010 (TBLA0A08010)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    TBLA_0A08010 (TBLA0A08010)
Enzymes [BR:tbl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     TBLA_0A08010 (TBLA0A08010)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 14493242
NCBI-ProteinID: XP_004178110
UniProt: I2GWT9
LinkDB All DBs
Position
1:1981576..1982862
Genome map
AA seq 428 aa AA seqDB search
MLIRRLFSSSACRAGISKINVKSPVVEIDGDEMTRVIWSEIKDRLILPYMNVGLKYYDLS
ITNRDKTNDQVTIDAAEAIKKYGVGIKCATITPDEKRVEEFGLKKMWKSPNGTIRNIVGG
TVFREPIIIPRIPRLVSTWEKPIIIGRHAHADQYKCSDFIVPGEGKLEMIFTPKDPSKAK
DVYKVYDFKGPGVGMGMYNTDDSIRGFAYSSFNLAVNKNMNLFLATKNTILKKYDGRFKD
IFQEIYENEYKKEFERLNITYEHRLIDDMVAQMIKSKGGYIMALKNYDGDVQSDIVAQGF
GSLGLMTSILASPDGKTFESEAAHGTVTRHFRRYQKGEETSTNSIASIFAWSRGLIKRGE
LDETLDVVNFGKLLEDATLKTVQVDGIMTKDLALATGKTSRDSYVDTFKFLEAVQFRLAN
GFNDLVRF
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcttatccgcagacttttttctagttctgcttgtagagctgggatctcgaagattaat
gtcaaatcgccagtagttgaaatagatggtgatgaaatgactagagttatttggtctgaa
attaaagatcgtttaatcttaccatatatgaatgtgggtttgaaatattatgatctttcc
attaccaatcgtgataagaccaatgatcaagttacaattgatgctgcagaagctattaag
aagtatggtgtaggtattaaatgtgccaccattacaccagatgaaaaaagagtagaggag
tttggattgaagaaaatgtggaaatctccaaatggtactatccgtaatattgttggcggt
acagtctttagggaaccaattattattccaagaattccaagattagtatccacttgggaa
aagccaattattatcggtagacatgcgcatgccgatcaatataaatgtagtgactttatt
gttcctggcgagggaaaattggaaatgatttttacaccaaaggacccatcaaaggctaaa
gatgtttacaaggtttatgatttcaaaggcccaggtgttggtatgggtatgtacaacact
gacgattctattagagggtttgcttattcttctttcaatcttgctgtcaataaaaatatg
aatttattcttggctactaagaatactattttgaagaaatatgatggtagatttaaagat
attttccaagaaatttatgaaaatgaatataagaaggaatttgaaagattaaacattaca
tacgaacaccgtttgattgatgatatggttgctcaaatgattaaatccaaaggtggttat
ataatggctctaaagaattatgacggtgatgttcaaagtgatatcgtggctcaaggtttt
ggctcattaggtttaatgacatctatcttggcttccccagatggtaaaacttttgaaagt
gaagccgctcatggtaccgttactagacattttagaagatatcaaaagggcgaagaaaca
agtaccaattccattgcatcaatcttcgcctggagtagaggcttaattaaaagaggtgaa
ttagatgaaactttggacgtcgtcaatttcggtaaattattagaagatgctaccttaaag
actgttcaagttgatggcatcatgaccaaagatttagctttagccactggtaagacttca
agagactcttacgttgatactttcaagtttttagaagctgttcaattccgtctggccaat
gggttcaacgatttagttcgtttttaa

DBGET integrated database retrieval system