KEGG   Tetrapisispora blattae: TBLA_0A08810Help
Entry
TBLA_0A08810      CDS       T02489                                 

Gene name
TBLA0A08810
Definition
(RefSeq) hypothetical protein
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tbl  Tetrapisispora blattae
Pathway
tbl04011  MAPK signaling pathway - yeast
tbl04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    TBLA_0A08810 (TBLA0A08810)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    TBLA_0A08810 (TBLA0A08810)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tbl01001]
    TBLA_0A08810 (TBLA0A08810)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tbl03036]
    TBLA_0A08810 (TBLA0A08810)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tbl04147]
    TBLA_0A08810 (TBLA0A08810)
Enzymes [BR:tbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     TBLA_0A08810 (TBLA0A08810)
Protein kinases [BR:tbl01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   TBLA_0A08810 (TBLA0A08810)
Chromosome and associated proteins [BR:tbl03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     TBLA_0A08810 (TBLA0A08810)
Exosome [BR:tbl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TBLA_0A08810 (TBLA0A08810)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Kdo APH
Motif
Other DBs
NCBI-GeneID: 14493761
NCBI-ProteinID: XP_004178189
UniProt: I2GX18
LinkDB All DBs
Position
1:2161249..2162304
Genome map
AA seq 351 aa AA seqDB search
MGKKIVFNISSEFQLKSLLGEGAYGIVCSAVYKPTGEIVAIKKIEPFEKPLFALRTLREI
KILKHFQHENIISIFDIQRPESFENFNEVYIIQELMQTDLHRVISTQTLTDDHIQYFLYQ
TLRAVKTLHGSNVIHRDLKPSNLLINSNCDLKICDFGLARIDNGNEPNEGKTPETSAMTE
YVATRWYRAPEVMLTAAKYSKAMDVWSCGCILAELFLKRPIFPGKDYRHQLMLIFGFLGT
PTMDDLECIESKRARDYISSLPKYKAVNLEKTFPNVNPLGLDLLHKMLLFNPNNRITAEQ
ALEHPYLRTYHEPNDEPEGEPIPPSFFVFDNYKDSLTTKDLKKLLWNEIFN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaaaaattgtctttaatatttcaagtgaatttcaattgaaatccttactaggt
gagggtgcttatggtattgtttgctctgcagtttataaaccaactggggaaatagtagca
ataaaaaaaattgaaccatttgaaaaaccattatttgctttacgtacattgagagaaata
aaaattttaaagcacttccagcatgaaaatatcatctcaatttttgatattcaaagacca
gagagctttgaaaattttaatgaagtatatattattcaagagctgatgcaaacagatttg
catcgtgttatatctactcaaacattaactgatgatcatattcaatattttttatatcaa
acattaagggcagtaaaaactttgcatggttcaaatgtaattcatagagatttaaaacct
tcaaatttactaattaattcaaactgtgatttaaaaatatgtgacttcggtttagcaaga
attgataatgggaatgagcctaatgaggggaaaacaccagagactagtgcaatgacagaa
tatgtagcaacaagatggtatagagcccctgaagtaatgcttactgctgccaagtattca
aaggctatggatgtctggtcgtgtggctgtatacttgcagaattattccttaaaagacct
atttttcctggtaaagattatagacatcaattaatgttaatttttggattcttaggaact
ccgactatggacgatctagagtgtattgagtctaaaagagcaagagattatatttcgagt
ttgccaaaatacaaagcagtaaatttagaaaaaacatttccaaatgtgaatccactagga
ttagatctattgcataagatgctactatttaacccaaataatagaatcactgcggaacaa
gcactggagcacccatatttaagaacttatcatgaaccaaatgatgaaccagaaggggag
ccaatacccccaagtttttttgtttttgataattataaggattcattgacaacgaaagat
ttaaagaagctgctttggaacgagattttcaattaa

DBGET integrated database retrieval system