KEGG   Tetrapisispora blattae: TBLA_0A10080Help
Entry
TBLA_0A10080      CDS       T02489                                 

Gene name
TBLA0A10080
Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tbl  Tetrapisispora blattae
Pathway
tbl00020  Citrate cycle (TCA cycle)
tbl00190  Oxidative phosphorylation
tbl01100  Metabolic pathways
tbl01110  Biosynthesis of secondary metabolites
tbl01130  Biosynthesis of antibiotics
tbl01200  Carbon metabolism
Module
tbl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tbl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tbl_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TBLA_0A10080 (TBLA0A10080)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TBLA_0A10080 (TBLA0A10080)
Enzymes [BR:tbl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TBLA_0A10080 (TBLA0A10080)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Thi4 Pyr_redox_2 FAD_binding_3 DAO HI0933_like NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 14492671
NCBI-ProteinID: XP_004178307
UniProt: I2GXD6
LinkDB All DBs
Position
1:2479840..2481729
Genome map
AA seq 629 aa AA seqDB search
MLSAIRKSAISSTNRIAIYKRTMATATENVGDKYNIVDHEYDCVVVGAGGAGLRAAFGLA
EAGFKTACISKLFPTRSHTVAAQGGINAALGNAHPDDWKWHMYDTVKGSDWLGDQDSIHY
MTREAPKSIIELEHFGMPFSRLENGRIYQRAFGGQSKNYGKDGQAYRTCAVADRTGHAML
HTLYSQALKHDTHFFIEYFALDLLKHNGEIVGVMAYNQEDGTIHRFRAHKTIIATGGYGR
AYFSCTSAHTCTGDGNAMVSRAGFPLQDLEFVQFHPSGIYGSGCLITEGARGEGGFLINS
EGERFMERYAPHAKDLASRDVVSRAITVEINEGRGVGKDKDHIFLQLSHIPETVLKERLP
GISETAQIFAGVDVTKEPIPILPTVHYNMGGIPTKWTGEALTINQETGEDEVIPGLMACG
EAACVSVHGANRLGANSLLDLVVFGRAVSHTISDTLQPGLPHKKLPSDLGKEALIRLDNY
RNTTGNTNTAAIRLKMQKSMQKNCSVFRIQETLDEGVRSINKIDAEFKGDVKVTDKSMIW
NSDLVETLELENLLTCATQTATAAANRKESRGAHAREDYSKRDDENWMKHTLTWQKKTGD
PVEIKYRNVITQTLDAEECPTVPPGIRSY
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgttatctgctattagaaaaagtgcgattagttccactaatagaatagctatctataag
agaactatggctaccgccacagaaaacgttggtgacaaatacaacattgttgatcatgaa
tatgattgtgttgttgttggtgctggtggtgctggtctaagagctgcctttgggttagct
gaagctgggtttaaaactgcttgtatttccaaattattcccaacaagatcccacactgtt
gctgctcaaggtggtatcaatgctgccttaggtaatgctcatccagatgattggaaatgg
cacatgtatgatactgttaaaggttctgattggttaggtgaccaagattccattcattat
atgactcgtgaagctccaaaatctattattgaattagaacattttggtatgccattctct
agattggaaaatggtagaatttatcaaagagcctttggtggtcaaagtaaaaattacggt
aaagatggtcaagcttatagaacttgtgctgtcgccgatagaacaggtcatgctatgctg
catacattatattctcaagctttgaaacatgatactcattttttcattgaatattttgcc
ctggatctattaaaacataacggcgaaatcgttggtgttatggcttataaccaagaagat
ggtactatccatagattcagagctcataagactatcattgccactggtggttatggtaga
gcttatttctcttgtacctcagcacacacatgtactggtgatggtaatgcaatggtttca
agagctggtttcccattgcaagatttggaattcgttcaattccatccatctggtatctat
ggttcaggttgtttgattactgaaggtgcccgtggtgaaggtgggtttttaattaactct
gaaggtgaaagatttatggaacgttatgctccacatgctaaggatttagcttccagagat
gttgtttccagagccattactgtcgaaatcaatgaaggtagaggtgtcggtaaagataaa
gaccacattttcttacaattaagtcatattcctgaaactgttttgaaggaaagattgcca
ggtatttctgaaactgcacaaatttttgctggtgttgatgtgactaaggaaccaattcca
attttaccaactgttcattacaatatgggtggtattccaactaaatggactggtgaagct
ttaacaatcaatcaagaaactggtgaagatgaagtcattccaggtttgatggcctgtggt
gaagctgcatgtgtctcagttcatggtgctaatagattaggtgcaaattccttattagat
ttagttgtctttggtagagctgtctcgcatactatttccgatactttacaaccaggttta
cctcataagaaattgccaagtgatttgggtaaagaagctctaattagattagataactat
agaaacactactggtaacacaaacacagctgccatcagattaaagatgcaaaaatctatg
caaaagaactgttctgtgtttagaattcaagaaactttagatgaaggtgttagatctatt
aataagattgatgctgaatttaaaggtgatgtaaaggttactgataaatccatgatttgg
aatagtgatttagtggaaactttagaattggaaaacttattaacctgtgccacacaaact
gctacagctgctgctaacagaaaggaaagtcgtggtgctcatgcaagagaagattattcc
aagagagatgatgagaattggatgaaacacactttgacatggcaaaagaagactggtgat
ccagttgaaattaaatacagaaatgttataacccagactttagatgctgaagaatgtcca
actgttccaccaggcattagatcatattaa

DBGET integrated database retrieval system