KEGG   Tetrapisispora blattae: TBLA_0B06900Help
Entry
TBLA_0B06900      CDS       T02489                                 

Gene name
TBLA0B06900
Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
tbl  Tetrapisispora blattae
Pathway
tbl00500  Starch and sucrose metabolism
tbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TBLA_0B06900 (TBLA0B06900)
Enzymes [BR:tbl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     TBLA_0B06900 (TBLA0B06900)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 14494566
NCBI-ProteinID: XP_004179030
UniProt: I2GZF9
LinkDB All DBs
Position
2:1632438..1634273
Genome map
AA seq 611 aa AA seqDB search
MFCYYILLIFFLFSIIWGDGIENEGIRPQSFNAGKNNLIDYYIGKLNKNTNEIEKADESI
SKHFNIILKNITFSTETTPVELEEWISTTKSESFQRVLHNINDKSLWGDSNINFKDRKDI
PEGVVIASPSKKDPDYFYQWARDSALVLNSVLTKLFDIPKEELLTENKNTLKYNETLFNT
MMKYINNTYYLQRLDNPSGKFDGVNNKNLGEPKWNCNNTAFVQGWGRPQNDGPALRSMVI
LKFLIKLHSIKNSLNVELPDKLFHPFFSSEWEIFNDIIKYDIEFIIKNWKTDGFDLWEEV
YGNHFFTSISQLKALQLIIKYLEISGFTTTNYRNELNDFKETATKSYYKLLNYVFFEGEY
IDSNKNFLIESPIQFRNGQRSGLDIAILLGSLYTHDDEEYGNSVDINETGLFPFDVNDSM
VLNTLYNLMQSMKGIYPINNRYFGVNTGVALGRYPEDVYDGVKVSEGNPWFLATLSASEI
LYNVIYKYQVNKRDLVIPLNSMNNQFWETLFINLNEEHLNLQLSKEEDDNNSTGNYLIVP
YESKMFNETMNSLHLLADSFLDRVMTHQGKNYEMSEQFNKYTGYLQGAEHLTWSYSAFCS
ALTARDRVIHM
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgttttgctattatattctacttatattttttttattttctattatatggggtgatggc
attgaaaatgaaggaattaggcctcaatcttttaatgcagggaaaaataatttgattgat
tattacattggtaaattaaataaaaatacaaacgaaatcgaaaaagctgacgaatcaatt
agtaaacattttaatatcatattgaaaaatattactttttctactgaaacgactccagtt
gaattagaagaatggatatcaactacaaagtcagaatcgttccaaagagtcttacacaat
atcaatgataaatcattatggggtgattcaaacataaatttcaaagatagaaaagatatt
ccagaaggtgttgttattgcttcaccatctaaaaaagatcctgattatttctatcaatgg
gcaagagatagtgctttagttttaaattctgtcctcacaaaattatttgatattccaaag
gaagaattattaaccgaaaataagaacactttgaaatataacgagactcttttcaatact
atgatgaaatatatcaataatacttattatttacaaagattagataatccatcaggcaag
tttgatggtgttaataataaaaatttaggtgaacctaaatggaattgtaacaatacagca
ttcgtacaaggttggggtagaccacaaaatgatggtccagcattaagatcaatggttata
ttgaaatttctaattaagttacactcgattaaaaattcgctaaatgtagaattaccagat
aaacttttccatccatttttctccagtgaatgggaaatatttaatgatattattaaatat
gatatagaatttattataaaaaattggaaaactgatgggtttgatctttgggaagaagta
tacggtaatcatttttttactagcatcagtcagttaaaggcattacaattaataattaaa
tacttggaaattagtggatttacaacaactaattataggaatgaattaaatgactttaag
gagactgccacaaagagttattataaattattaaattatgtttttttcgaaggtgaatac
attgattctaataaaaacttcttaattgaatcaccaatacaatttagaaatggtcaacgt
tctggtttagatattgctattctattaggctcattatatactcatgatgatgaagagtat
ggaaattcagtagatataaatgagactggactattcccatttgatgtcaatgattccatg
gtactaaacacattatacaatttaatgcaatccatgaaaggcatctatccaattaacaat
agatactttggggtcaacacaggggttgcattaggaagatatccagaggatgtatatgac
ggtgttaaagtatcagagggcaatccttggtttttagcaacattatcagcatctgaaatt
ttatacaacgtaatttataaatatcaagttaacaagagagatttagtgattccattaaat
tctatgaataaccaattttgggaaactctcttcatcaacttaaatgaagaacatttgaat
ctacaactttctaaagaagaagatgataataattctacaggaaattatttaattgtccca
tatgaatccaaaatgttcaatgaaaccatgaattctttacacttattggcagactctttc
ctagatagagtaatgacccaccagggaaagaattatgaaatgagtgaacaatttaacaag
tatactggatacctccaaggagctgaacacctaacctggtcatattccgcattctgttct
gctttaactgctagagatagagtgatacatatgtag

DBGET integrated database retrieval system