KEGG   Tetrapisispora blattae: TBLA_0B07880Help
Entry
TBLA_0B07880      CDS       T02489                                 

Gene name
TBLA0B07880
Definition
(RefSeq) hypothetical protein
Organism
tbl  Tetrapisispora blattae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 14494331
NCBI-ProteinID: XP_004179123
UniProt: I2GZQ2
LinkDB All DBs
Position
2:1868891..1869670
Genome map
AA seq 259 aa AA seqDB search
MNNNNSRYIIRNHRFLESLKCFEKYSSSSKIKNDFDYGKILKQQHIDSKFVISEQEIDIE
TDNPQYITNTNNRVKRTSIQSYNFNSPKYQHIDDTVGNSMYQEYLEYIKSNPLQTTLGDF
DQVKDDRFIYEGLYDRNRIILDNFHINDRYNDSTASNVFSIPNGFNPRLARNMAANEKVD
KWINKIPIIISKRGDITPNCFEPSFSFNWEEFDFDNETGENNFESIDDLLFLQNKKVDAL
VRKMYMRENEIYNVGNPYI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaataataataattccaggtatataattagaaaccacagattcttagaaagtttaaaa
tgttttgaaaaatattcttcttctagtaaaatcaaaaatgattttgattatggtaaaata
ctaaaacagcagcatatcgatagtaaatttgtaattagtgagcaagaaatagatattgaa
actgataatccacaatatattacaaatacaaataatagagtgaaaagaacatcgatacag
tcatataattttaattcaccaaaatatcaacatatagatgatactgttggcaattcgatg
tatcaagaatatcttgaatatattaaaagtaatcctttacagacaactttaggtgatttt
gaccaggtaaaggatgatagatttatttacgagggattgtatgatcgcaatagaataatc
ctggataatttccatataaatgaccgttataatgatagcactgccagtaacgtttttagt
attccaaatggttttaatccaagattggcaagaaatatggcagctaacgagaaggtggat
aaatggataaataaaatacccatcataatatcgaagagaggagatattactccaaattgt
ttcgagcccagctttagtttcaattgggaagaattcgattttgataatgaaactggggaa
aataatttcgaatctattgatgatcttttgtttctacaaaacaagaaagttgacgctctg
gtacgtaagatgtacatgagagaaaatgagatttataacgttggcaatccttacatttaa

DBGET integrated database retrieval system