KEGG   Tetrapisispora blattae: TBLA_0B08810
Entry
TBLA_0B08810      CDS       T02489                                 

Gene name
TBLA0B08810
Definition
(RefSeq) hypothetical protein
  KO
K12766  serine/threonine-protein kinase MDS1/RIM11 [EC:2.7.11.1]
Organism
tbl  Tetrapisispora blattae
Pathway
tbl04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    TBLA_0B08810 (TBLA0B08810)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tbl01001]
    TBLA_0B08810 (TBLA0B08810)
Enzymes [BR:tbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     TBLA_0B08810 (TBLA0B08810)
Protein kinases [BR:tbl01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   TBLA_0B08810 (TBLA0B08810)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Choline_kinase WHIM1 APH
Other DBs
NCBI-GeneID: 14494760
NCBI-ProteinID: XP_004179216
UniProt: I2GZZ5
LinkDB
Position
2:2094401..2095375
AA seq 324 aa
MKLLNHINLLNLKYYFYEKDPQDEVYLNLIIDYMPQSLYQRLRHFVHQKSSMSRLEIKIY
MFQLFKALNYLHNIVSVCHRDIKPQNLLVDPETWSLKLCDFGSAKQLKPTEPNVSYICSR
YYRAPELIFGATNYTNQIDIWSTACVMAELLLGQPMFPGESGIDQLVEIIKILGTPTKQE
ICAMNPNYMDHKFPAIKPIPLTQVFKKEDDYTVEFLTNLFKYDPQERLNALQCLCSDYFK
DISLPDKDTIAPSSSINTNPNSDPLANTTAITTINTDAFIQNREIIEQKTKDLKLMIFDK
KNDLGFLTENQLNAVKQKLNPVLI
NT seq 975 nt   +upstreamnt  +downstreamnt
atgaaattattgaatcatatcaatctattaaatttgaaatattatttctatgaaaaggac
ccacaagatgaggtttatttaaatttaatcattgattatatgccacaatccttatatcag
agattaagacattttgtccatcaaaaatcttccatgtctcgattagaaatcaagatttat
atgtttcaattatttaaggcattaaattatttacataatatagtttcagtttgtcataga
gatattaaaccacagaacttattggtggatcctgaaacttggtcattaaagttatgtgat
tttggtagtgcaaaacaattgaaacctacagaacccaatgtttcatatatttgttctcgt
tattatagagcaccagaattaatctttggtgctaccaattatacaaaccagattgatatt
tggtctactgcatgtgttatggcggaattgttattgggacaaccaatgtttcccggtgaa
agtggtattgaccaattggtcgaaattattaaaattttaggaactccaactaagcaagag
atttgtgctatgaatcctaattatatggatcataaattccctgctattaaaccaattcca
ttaacacaagtatttaaaaaggaagatgattatacagtggaatttctaaccaatctattt
aagtatgatccacaagaacgacttaacgcattgcaatgtctatgtagtgattatttcaaa
gatatctctttacctgataaagataccattgctccatcttcatcaattaacactaatcct
aattcagaccccttggcaaacactactgccatcacgacaattaatactgatgcatttatt
caaaatcgagagattatagaacaaaagactaaagatttaaaactaatgatattcgataag
aagaacgatttagggttcctcacggagaatcaattgaatgcagtaaaacaaaaattgaac
cctgttttaatatga

DBGET integrated database retrieval system