KEGG   Tetrapisispora blattae: TBLA_0E01400Help
Entry
TBLA_0E01400      CDS       T02489                                 

Gene name
TBLA0E01400
Definition
(RefSeq) hypothetical protein
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
tbl  Tetrapisispora blattae
Pathway
tbl00020  Citrate cycle (TCA cycle)
tbl00190  Oxidative phosphorylation
tbl01100  Metabolic pathways
tbl01110  Biosynthesis of secondary metabolites
tbl01130  Biosynthesis of antibiotics
tbl01200  Carbon metabolism
Module
tbl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tbl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tbl_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TBLA_0E01400 (TBLA0E01400)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TBLA_0E01400 (TBLA0E01400)
Enzymes [BR:tbl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TBLA_0E01400 (TBLA0E01400)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 SF3a60_bindingd Fer4_9 Fer4_7
Motif
Other DBs
NCBI-GeneID: 14496192
NCBI-ProteinID: XP_004180718
UniProt: I2H497
LinkDB All DBs
Position
5:complement(306440..307267)
Genome map
AA seq 275 aa AA seqDB search
MWTKQALSACKLAYKSVNYNTIVTGASTRGLATAAGSASPRFKTFKIYRWNPDTPSEKPF
LQEFKVDLNECGPMVLDALLKIKNEQDPTLTFRRSCREGICGSCAMNIGGRNTLACLCKI
DQNESKQLKIYPLPHMYIVKDLVPDLTNFYKQYKSIKPYLHRDKFPEDGKEILQSIEDRK
KLDGLYECILCACCSTSCPSYWWNNEEYLGPAVLMQAYRWLADSRDTANDMRKTMLNNSM
SLYRCHTIMNCTRTCPKGLNPGKAIAHIKSSLAFN
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtggactaaacaagctttgagtgcatgcaaattggcttacaagtcagttaattacaat
actatagtaactggagcttcaacaagaggtttggctacggcagctggttctgcaagccca
agatttaagacctttaaaatttatcgttggaatccagatactccttctgaaaaaccattt
ttgcaagaatttaaagttgatttaaatgagtgtggccctatggttttggatgcgttgtta
aaaattaaaaatgaacaagatcctactttgacctttagaagatcatgtagagaaggtatt
tgtggttcctgtgccatgaatattggtggtagaaataccttagcatgtttatgtaagatt
gatcaaaatgagtcaaagcaattgaagatctacccattacctcacatgtacattgttaaa
gatttggtaccagatttaaccaatttctacaagcaatataaatctattaaaccttattta
caccgtgataaattccctgaagatggtaaggaaattttacaaagtattgaagatagaaag
aaattagatgggttatatgaatgtattttatgtgcttgttgttccacctcttgtccttca
tattggtggaataatgaagaatatttggggcctgcagttttgatgcaagcttatcgttgg
ttagctgattctagagatactgctaacgatatgcgtaagactatgttgaacaattcgatg
tctctatatagatgtcatactattatgaattgtaccagaacttgtccaaagggattgaac
ccaggtaaagcaattgctcacatcaaatcttccttagcctttaattaa

DBGET integrated database retrieval system