KEGG   Tetrapisispora blattae: TBLA_0E04440Help
Entry
TBLA_0E04440      CDS       T02489                                 

Gene name
TBLA0E04440
Definition
(RefSeq) hypothetical protein
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
tbl  Tetrapisispora blattae
Pathway
tbl00220  Arginine biosynthesis
tbl00250  Alanine, aspartate and glutamate metabolism
tbl01100  Metabolic pathways
tbl01200  Carbon metabolism
tbl01210  2-Oxocarboxylic acid metabolism
tbl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TBLA_0E04440 (TBLA0E04440)
   00220 Arginine biosynthesis
    TBLA_0E04440 (TBLA0E04440)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tbl01007]
    TBLA_0E04440 (TBLA0E04440)
Enzymes [BR:tbl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     TBLA_0E04440 (TBLA0E04440)
Amino acid related enzymes [BR:tbl01007]
 Aminotransferase (transaminase)
  Class I
   TBLA_0E04440 (TBLA0E04440)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 SirA
Motif
Other DBs
NCBI-GeneID: 14496571
NCBI-ProteinID: XP_004181017
UniProt: I2H546
LinkDB All DBs
Position
5:complement(1138820..1140508)
Genome map
AA seq 562 aa AA seqDB search
MIKTCNRHSSHSLRGMSQTTLFKSPSSSSLFRSTSSSSLYIPPPTALVRSISSSSILSNS
SNASVTSPLSYSTSREKSYFAERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPG
TLPFESVINSNIGNPQQLGQKPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAK
TLLTDIGSIGAYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSIL
CKGQQTGVLIPIPQYPLYTATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIK
PTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILR
ILQKEVPNKYDNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSS
VIGQALVDLMCCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGA
MYMFPNIQLPFNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFL
APGVEWMKRWEKFHIEFFEKYR
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaacatgcaacagacattcttctcattcattgagaggaatgagtcaaacaact
ctttttaaatcgccctcatcttcgtctttatttaggtcaacatcgtcttcttcgctttat
attccacctcctacagctttagtacgtagtatttcttcatcatctattttatctaattct
tcaaatgcctccgttacatcaccgctctcgtactcgactagtcgtgaaaaatcatatttt
gcagaaaggttggaaccagaggatttgaaccccaatgtcgttaaggctaaatatgcggtt
cgtggtgccattccctcatacgcagacaaattgaagatccaattgttgaaacatccagga
accttgccttttgaatcagtcatcaattctaatatcggtaatcctcaacaactgggccaa
aaacctttgtcttttggcagacaagttctttctattttagaatatcctgcattattagat
catgaaagaactctggttgattctatggggtatgcaccagattccatagaaagagccaag
actctattgacagacattggatctataggtgcttattccaattctcaaggtgttcatggt
attagacaaactgtggcagatttcattactaatcgtgatgatggtgaagtcgcttatcca
gatgatattttcttaactgctggtgcctcatctgccgtttctaccattttgtccattcta
tgtaaaggtcaacaaacgggtgttttaattccaattcctcagtatccgttgtataccgcc
accttaactttaaatgatgccacagcattaccttattatttagacgagtcgaatggttgg
tctacagatattaatgaaatttcaaaagtcgcacaagattcattagaagcaggtattaaa
cctacttgccttgttgtgataaacccagggaacccaacaggatccgtcttaactgtagaa
gctattaaaaacgttttcgatgttgctgctaaatatgggttagtagtcattgcagacgaa
gtataccaagataacatcttcccagggtctgaattccattcgatgaaaaaaattttaaga
attttacaaaaagaagtccccaataaatatgataatatccaattagcctctttacattca
tgttcaaagggtttattaggtgaatgtggtcatagaggtggttattgtgaatttattgga
tttacaccagaagttaaacaagtgataacaaaattatcttcaatctctctatgttcttca
gttattggccaagctcttgtagatttgatgtgttgtccaccaaagaaaggtgaaccttct
tatgaattagatcaacatgaaagacaaaccattagaaccaatcataagaaaagatcaaat
aaattgtatgagatgttcaattcattagaaggcgttacttgtcaaaaacctcaaggtgcc
atgtatatgttccctaacattcaattaccttttaatgctataaagatggctcaaaatttg
gatataacaccagatgaattctattgtagagaattattaaaggcaacaggtatctgtact
gtgccaggctcagggtttggccaacaaccaggtacttaccatgtaagaaccaccttttta
gctccaggtgttgaatggatgaaaagatgggaaaaattccatattgaattttttgaaaag
tatcgctaa

DBGET integrated database retrieval system