KEGG   Tetrapisispora blattae: TBLA_0E04500Help
Entry
TBLA_0E04500      CDS       T02489                                 

Gene name
TBLA0E04500
Definition
(RefSeq) hypothetical protein
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
tbl  Tetrapisispora blattae
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tbl01009]
    TBLA_0E04500 (TBLA0E04500)
Protein phosphatases and associated proteins [BR:tbl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TBLA_0E04500 (TBLA0E04500)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_9 LRR_6 LRR_1
Motif
Other DBs
NCBI-GeneID: 14496576
NCBI-ProteinID: XP_004181022
UniProt: I2H551
LinkDB All DBs
Position
5:1146859..1147902
Genome map
AA seq 347 aa AA seqDB search
MSDSEEQKPKIIDTSKLQLDDPDTKIAPMVIPDNNPDLISADSDLTVDLPDNIETIDLVH
LKIRSLEDLNLLRFKQLKILCLRQNLVESISEVEVLPADTLVELDFYDNRIKHISANVNK
LINLESLDFSFNKIKNIKNIDKLVNLKYLYFVQNKISKVENLSTLKNLVSLELGGNRLTD
LHPDSFVGLDKLEEIWLGKNMIPRLINLSPLKSLKILSIQGNRLKKLEGLDELTNLEELY
VSHNQISKIENLEKNLKLTTVDISSNKITKIENVSHLKMLTDLWCSFNQIDQSFESLGEE
LKDLSRFETIYLEGNPIQLNNETSYRRKLILNLPKSLNKIDATFIRD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtctgattctgaagaacaaaaaccaaaaatcattgatacaagtaaattacaattggat
gatccagatactaaaatagcacccatggtgatccctgataataatccggaccttatatct
gctgatagcgatttgacggtagatttacctgacaatatagaaacgatagatttggttcat
ttgaaaatacgatcgttagaagacttgaatctattgagattcaagcaattgaaaatttta
tgtttaagacaaaatttagtagaaagtatttcagaagtagaggttttgcctgctgatacc
cttgtagaattggatttttatgacaatagaataaagcatatttcagctaatgtgaataaa
ttgatcaatttggaaagtttggatttctcattcaataagattaaaaatattaagaatatt
gacaaattggtcaatttgaaatacctttattttgttcaaaacaagatttctaaagtagaa
aatttatctactttgaaaaatttggtttcactagaactcggtggtaatcgtcttacagat
ctacaccctgattcttttgtaggattggataagttagaagaaatttggttaggtaaaaat
atgatccctcgtttaataaacttgtctcctttaaaatcattaaagattttatctattcaa
ggtaatagattgaagaaactggaaggattagatgaattgactaatttggaagaattatat
gtatcacataatcaaatttcaaagattgaaaatttagaaaaaaatttaaaattaactaca
gttgatatttcctccaacaagattactaagattgaaaatgtttctcatttgaaaatgttg
actgatttatggtgttcttttaatcaaattgatcaatcatttgaatcattgggtgaagaa
ttaaaagatttatcaagatttgaaacaatttatttggaaggtaatccgattcaactaaat
aatgagacttcttatagaagaaaattgattttgaatttaccaaaatctttgaataaaatt
gacgctacttttattcgtgattaa

DBGET integrated database retrieval system