KEGG   Tetrapisispora blattae: TBLA_0G02000Help
Entry
TBLA_0G02000      CDS       T02489                                 

Gene name
TBLA0G02000
Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
tbl  Tetrapisispora blattae
Pathway
tbl04146  Peroxisome
tbl04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    TBLA_0G02000 (TBLA0G02000)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    TBLA_0G02000 (TBLA0G02000)
Enzymes [BR:tbl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     TBLA_0G02000 (TBLA0G02000)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 14497274
NCBI-ProteinID: XP_004181661
UniProt: I2H6Z0
LinkDB All DBs
Position
7:complement(523522..523986)
Genome map
AA seq 154 aa AA seqDB search
MVNAVCILTGSAGVSGLVRLTQESEDAPTTIEYEITGNTPNAERGFHIHQFGDLTNGCVT
AGPHFNPFGKTHGSLTSEIRHVGDLGNVKTDANGVAKGTIVNDTIKLMGPYSVVGRAFVI
HAGTDDVGLGGNEESLKTGNAGGRNACGTIGLSA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcaacgctgtctgtatcttaaccggttctgctggtgtctctggtttagtccgtctt
actcaagaatctgaagacgctccaaccaccattgaatacgaaatcacaggtaatactcca
aatgctgaacgtgggttccatatccatcagtttggtgatttaaccaatggttgtgtaact
gctggtccacatttcaatccatttggtaagacccatggttctttgacctcagaaattaga
catgtaggtgatttaggtaatgttaagaccgatgctaatggtgtcgctaaaggtaccatc
gtcaacgacactatcaagttgatgggtccttattctgttgtcggtagagcctttgtcatt
cacgctggtaccgatgacgtgggtctaggtggtaacgaagaatccttaaagactggtaac
gcaggtggtagaaacgcttgtgggactattggtttatccgcttaa

DBGET integrated database retrieval system