KEGG   Thiolapillus brandeum: TBH_C2240Help
Entry
TBH_C2240         CDS       T03600                                 

Definition
(GenBank) biopolymer transport protein TolA
Organism
tbn  Thiolapillus brandeum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_2 TolA TonB_C DUF5401 AF-4
Motif
Other DBs
NCBI-ProteinID: BAO45151
UniProt: W0TQQ4
LinkDB All DBs
Position
complement(2443036..2443980)
Genome map
AA seq 314 aa AA seqDB search
MLELIRRHPLAFFLALLMHLAILALMVFGLDWLNPPRPVKPAGPIVHATLVDTSQLQRRK
EKKQAQKRLAAEKQKKLEEQRKAQARKQAEEKRRKEQETRRQQEKKKKAEQQRKEELRKK
AEIEKKRKLALKKKEAEKKKKAELERQRKLKEKKRREEARKKAEEKRKAEAKKKAEAERK
KKEIARRKAEAEKKRKAREAAERKAREAEMQAQWEAEKEGRERASVTAAIKRKVQNNWLR
PPSSGNKGQEATVRVRLNEKGSVLLVQVVKSSGNAAFDRSVVTAVNKADPLPMPKSPRLI
SEFRDFTFIFRPTK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaacttatccgtcgccatcccctggccttttttctggcactgctcatgcacctg
gcgattctggccctgatggtttttggtctggactggctcaatcccccccggccagtaaaa
ccggccgggccaatcgtccatgcgactctcgtggataccagccaactgcagcgccggaaa
gagaaaaagcaggcgcaaaaacgcctcgccgctgaaaagcagaagaaactggaggagcaa
aggaaagcccaggcccgcaaacaggccgaggaaaaacgccgcaaggagcaggaaaccagg
cgccaacaggaaaaaaagaaaaaggctgagcaacagcgaaaggaagaactgcgcaagaaa
gcggaaattgaaaagaagcgcaaactggccctaaagaaaaaggaagcagaaaaaaagaaa
aaagcggaactcgagcgccaacgcaagctcaaagaaaagaagcgcagggaagaggcgcgc
aagaaggctgaggaaaagaggaaagccgaagcaaagaagaaggccgaggcagaacgcaag
aaaaaggagatcgcgcgcaggaaagccgaggccgagaagaagcgcaaggcccgggaagca
gcggaacgcaaagccagggaagcggaaatgcaggcccagtgggaagccgaaaaggaaggg
cgggaacgggccagcgtcactgccgctatcaagcggaaagtgcagaacaactggctcaga
ccgccttcttccgggaacaagggacaggaagctaccgtacgcgtaaggctcaacgaaaaa
ggctcggtgctgctggtccaggtggtaaaatccagcggcaatgctgcttttgatcgttcg
gtggtaaccgccgtgaacaaggcggatccgttgcccatgccgaagtctccgcggctgata
tcggaattcagggactttactttcatattcaggcccacgaaatga

DBGET integrated database retrieval system