KEGG   Thermoanaerobacter brockii: Thebr_0368Help
Entry
Thebr_0368        CDS       T01409                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
tbo  Thermoanaerobacter brockii
Brite
KEGG Orthology (KO) [BR:tbo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:tbo03012]
    Thebr_0368
   03029 Mitochondrial biogenesis [BR:tbo03029]
    Thebr_0368
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tbo04147]
    Thebr_0368
Translation factors [BR:tbo03012]
 Eukaryotic Type
  Elongation factors
   Thebr_0368
 Prokaryotic Type
   Thebr_0368
Mitochondrial biogenesis [BR:tbo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Thebr_0368
Exosome [BR:tbo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Thebr_0368
  Exosomal proteins of breast cancer cells
   Thebr_0368
  Exosomal proteins of colorectal cancer cells
   Thebr_0368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW Peptidase_U32_C
Motif
Other DBs
NCBI-ProteinID: ADV78983
UniProt: E8UUW8
LinkDB All DBs
Position
397263..398465
Genome map
AA seq 400 aa AA seqDB search
MAKQKFERKKPHVNVGTIGHVDHGKTTLTAAITMVLSKAGMAEAKGYDEIDKAPEERARG
ITINTTHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKADMVDDPELIELVEMEVRELLNEYEFPGDDTPIVVGSALKALE
CGCGKRECEWCGKIWQLMDVVDEYIPTPERDIDKPFLMPVEDVFTITGRGTVATGRVERG
KVKVGDEVEIIGLTTESRKTVVTGVEMFRKTLDEAQAGDNIGVLLRGVQRDEVERGQVLA
KPGTIKPHTKFEAQVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGVINLPDGVEMVMPG
DHVTIKVELITPIAMEEGLKFAIREGGRTVGAGVVSAIIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcaaaaatttgagaggaagaagccccacgtaaacgtagggacgataggtcac
gtagaccatggtaagacgacgttgacagcagcgataacgatggtattatcgaaggcagga
atggcagaggcgaagggatatgacgagatagacaaggcgccggaggagagagcaagggga
ataacgataaacacgactcacgtagaatatgagacagagaagaggcactatgcgcacgta
gactgtccaggacatgctgactatgtaaagaacatgataacaggggcagcacagatggac
ggggcgatattagtagtatcagcagcagacggaccgatgccacagacgagggaacacata
ttattggcgaggcaggtaggagtgccatatatagtagtatttttaaacaaggcagacatg
gtagacgatccagaattaatagaattagtagagatggaagtaagggaattattgaatgaa
tatgagtttccgggggatgacacaccgatagtagtagggtcagcacttaaggcattagag
tgtggatgtggcaagagagagtgcgaatggtgcgggaagatatggcagttaatggatgta
gtagacgaatatataccgacaccggagagagacatagacaagccattcttaatgccagta
gaggacgtatttacgataacaggaagaggaactgttgcgacagggagagtagagagaggg
aaggtaaaggtaggagacgaagtagagataataggattgacgacggaatcaaggaagaca
gtagtaacaggggtagagatgttcaggaagacactggatgaggcgcaagcaggagacaac
ataggagtattattaagaggagtacagagggacgaagtagagagagggcaagtattagcg
aagccagggacgataaagccgcacacgaaatttgaggcacaagtttacgtattgacgaag
gaagaaggaggaaggcacacaccatttttcaatggatacaggccacaattttactttagg
acgacagacgttacaggtgtaataaacttgccggatggagtagagatggtgatgccaggt
gaccacgtaacgataaaagtagagttaataacaccgatagcgatggaagaaggtttgaag
tttgctataagagaaggcggccgtacagtaggtgctggcgtcgtgtcagctatcatagaa
taa

DBGET integrated database retrieval system