KEGG   Thermoanaerobacter brockii: Thebr_0487Help
Entry
Thebr_0487        CDS       T01409                                 

Definition
(GenBank) DNA polymerase LigD, ligase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tbo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Thebr_0487
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tbo03400]
    Thebr_0487
Enzymes [BR:tbo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Thebr_0487
DNA repair and recombination proteins [BR:tbo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Thebr_0487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme PI_PP_I
Motif
Other DBs
NCBI-ProteinID: ADV79094
UniProt: E8UVF1
LinkDB All DBs
Position
complement(497022..497945)
Genome map
AA seq 307 aa AA seqDB search
MSMIEEKISPMLASSSDPFDSPEWIYEIKWDGSRTIAFLSNKTRLQDRRLVDITHQFPDL
ALLYKQIKAKEAILDGELVVLKNGKPSYKSIMSRKHQQNLVKINLLSKIMPVIFITWDIL
YLNGKSLVELPLIERKDILRKTVKENEIIKISDFIFEHGKMLFEETGKKGLEGIVAKKAD
SKYLIGKRSKLWLKSKHFIVINAVIIGYRTDKTALILGLYDEENNLINIGSCESGLSQKE
LKAFYEVAKEIKAPDNYYNFKEKNVQWLKPLLTCKVRFMEWSENMKMRAPSFIQFEYNVK
PEECRFE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgatagaagaaaaaatatcacctatgctggcatccagcagtgacccttttgat
agccccgaatggatatatgaaatcaaatgggatggttcaaggactattgcctttctttca
aataaaacaagacttcaagatagaaggcttgttgatataacccaccagtttccggatttg
gcattactttataagcaaataaaagcaaaagaagcaatacttgacggtgaacttgtagtt
ttaaaaaacggcaagcccagttacaaaagcattatgtcgagaaagcatcaacaaaattta
gtaaaaataaatcttttaagcaagataatgcccgtaattttcataacatgggatatatta
tacttaaacggcaagtctcttgtagaattgccacttatagagagaaaagatatccttaga
aaaacagttaaagaaaatgagatcataaaaatatcagattttatatttgaacatggaaaa
atgctttttgaagagacagggaaaaaaggacttgaaggaattgttgccaaaaaagcagat
tcaaaatatttaataggaaaaaggagtaaactctggcttaagtcaaaacattttattgta
ataaatgctgttattatagggtacagaactgacaaaacagccctcatactggggctttac
gatgaggaaaataatttaataaacataggaagttgtgaatcaggcctatcccagaaggaa
ttaaaagcattctatgaagttgccaaggagataaaagccccagataattattataacttt
aaagaaaaaaatgtgcagtggttaaaacccttgctaacatgtaaagtgagatttatggaa
tggtctgaaaacatgaagatgagggcaccttcttttattcaatttgagtataacgtaaaa
ccagaagagtgcaggtttgaataa

DBGET integrated database retrieval system