KEGG   Thermoanaerobacter brockii: Thebr_0499Help
Entry
Thebr_0499        CDS       T01409                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo00473  D-Alanine metabolism
tbo01100  Metabolic pathways
tbo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tbo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Thebr_0499
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Thebr_0499
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tbo01011]
    Thebr_0499
Enzymes [BR:tbo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Thebr_0499
Peptidoglycan biosynthesis and degradation proteins [BR:tbo01011]
 Precursor biosynthesis
  Racemase
   Thebr_0499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADV79106
UniProt: E8UVM5
LinkDB All DBs
Position
507628..508794
Genome map
AA seq 388 aa AA seqDB search
MFDNIRPTRAEIYLDNIVHNLSEVKRWVGKKVKIMGVVKANAYGHGACQVAKVLIENGVS
YLGVATIEEALELRECGINIPILVFGYTPLPQAKELIVHNITQTVFDINYVKDLERIALN
VGKKAKVHVKVDTGMGRIGYTDLNVAEKEIEKMMEMEGVEVEGIFSHFATSDEKDKTYAE
QQFDMFKKLLESLKQKEINIPLKHIANSGAIIDLKYTYLDMVRPGIVLYGSYPSENVERP
LDLRQTMGFKTKIVYIKEVPEGTSISYGRTFITKRKSKIATLPVGYADGFNRLLSNNHHV
LVKGKYAPVIGRICMDQTMLDVTDIEGVEVGDDVTIFGNQDGEKITAEEIAKKLNTIPYE
VYCGISRRVPRIYIYKGEVIEVKNYLKI
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtttgataatataaggccaacaagagcagaaatatatttggataatatagtgcataat
ttgagtgaagtaaagagatgggtggggaagaaagtaaaaataatgggggtagtgaaagcc
aatgcttatggtcatggagcttgtcaagtagcaaaggttttaatagaaaatggggtttct
tatttgggagtagctacaatagaagaggcgttagaattaagggaatgcggaattaatatt
cccatactcgtttttggatatacgcctttacctcaggccaaagaattaattgtgcacaat
ataactcaaactgtttttgatataaactatgttaaagacttagaaagaattgccttaaat
gtgggtaagaaggctaaagttcatgtaaaagttgatacaggtatgggacggataggatat
acagatttaaatgtagctgaaaaagagatagaaaaaatgatggaaatggaaggggtagag
gtagaaggcatatttagtcattttgctacttctgatgaaaaagataaaacatatgctgaa
caacagtttgatatgttcaagaaattgttagaaagcttaaagcaaaaagagataaacatt
cctttaaagcatatagctaacagtggagcaattattgaccttaaatatacttatttagac
atggtaaggccaggaatagttctatacggtagttatccttcagaaaatgttgaaagacca
ttggatttaagacagactatgggttttaaaactaaaatagtgtatataaaagaagtacct
gaaggtacttccattagttatggaaggacatttataactaaaagaaaaagcaaaattgcc
acattgcctgtaggatatgctgatggttttaatagattactctctaataatcatcatgtc
ttagtaaaagggaaatatgctcctgtaattgggagaatttgtatggaccaaacgatgtta
gatgtcaccgatatagaaggagtagaagtaggtgatgatgtaactatttttggaaatcaa
gatggagaaaaaataacagcagaggagattgctaaaaaattaaatactataccttatgaa
gtatattgtggaatatctagaagggtacctcgaatatatatttacaaaggagaggtaatt
gaggtaaaaaattatttaaaaatttga

DBGET integrated database retrieval system