KEGG   Thermoanaerobacter brockii: Thebr_0542Help
Entry
Thebr_0542        CDS       T01409                                 

Definition
(GenBank) spore germination protein
  KO
K06296  spore germination protein KB
Organism
tbo  Thermoanaerobacter brockii
Brite
KEGG Orthology (KO) [BR:tbo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tbo02000]
    Thebr_0542
Transporters [BR:tbo02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Thebr_0542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_permease ETRAMP
Motif
Other DBs
NCBI-ProteinID: ADV79145
UniProt: E8UVR4
LinkDB All DBs
Position
complement(555716..556801)
Genome map
AA seq 361 aa AA seqDB search
MNKRLEVSDLLFLMITFEIGTSVLFCLGIKAKQDCWLSILIAMLISLPITLMYVSSFEKS
QKNLPQLLEFVYGKYIGKTLSLIYALYFLYIASRNVRDYVELSVNTIYSRTPTYIFSSFM
LILVMYYLLFDICVLARVAKILLPLILAIMAFQTTMIMMGDNFSFSRLLPILENGIVPVI
KAAIPLIVTFPFGELIAFTTVFDKVKQKEKIKKIMLITTVFTGLLLSFNNIIIISSLGAD
EASRENFPLYQVIRLINLGNLKNLDTLYVFIMIIGVFFKISVFTYAGLTMIKNALELKSY
KYLLFPVLSMIFAASFIIADSYQTHILIGLKFTPFYIHVPLQIILPMITFLFLNIKEKRK
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaagattagaagttagcgatttattgtttttaatgataacttttgagattgga
acatcagtactcttttgtttgggaattaaagcaaaacaagattgttggctttctatttta
attgcaatgcttatttctctgccaattacacttatgtacgtctcctcttttgaaaaatcg
caaaaaaatcttccacagttacttgagtttgtttatgggaaatatataggtaaaacttta
tctctaatttatgctctgtactttttatacattgcttcaagaaacgtaagagactatgta
gaactcagtgtaaatacaatatattctcgaacacctacatatattttttcttcttttatg
cttatattagtaatgtattacctcctatttgatatatgtgtacttgcccgcgttgctaaa
attttgctccctcttattttagctattatggcttttcaaacaactatgataatgatggga
gataattttagtttttcaaggcttttaccaattttagaaaatggaattgttcccgtaatc
aaagcagcaattcctctaattgtgacttttccatttggtgaacttattgcttttactaca
gtttttgataaagtaaaacaaaaggaaaagataaaaaagataatgctgataaccactgtt
tttactggtctactattgtcctttaacaatatcattataatttcttctttaggagcagat
gaagcttcaagagaaaatttcccattgtatcaagttataagattaataaatttaggaaat
ttaaaaaacctagacactttgtatgtatttataatgattataggggtattttttaagatt
agcgtatttacttatgcaggacttaccatgataaaaaatgcgttggaattaaaaagttat
aaatacctgcttttccctgttttgtcgatgatttttgctgcttcttttataattgccgac
agttatcaaacccacatacttataggtcttaaatttactcctttttacatacatgtacct
ctacaaataattttacctatgattacttttctatttctaaacataaaagaaaagagaaaa
ccttaa

DBGET integrated database retrieval system