KEGG   Thermoanaerobacter brockii: Thebr_0679Help
Entry
Thebr_0679        CDS       T01409                                 

Definition
(GenBank) regulatory protein TetR
Organism
tbo  Thermoanaerobacter brockii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N HTH_Tnp_1_2
Motif
Other DBs
NCBI-ProteinID: ADV79273
UniProt: E8UWJ1
LinkDB All DBs
Position
701402..701971
Genome map
AA seq 189 aa AA seqDB search
MEERNQSQRILNAAYKCISTKGYANVSLRDIAEEAGVVLSQLHYYFGSKEGLFTEVIKMM
IDKYLEEINEALSIGETAKDKMLSLVKFFKDLLSNNPGLFKLLYDFTGLAMWSSSFNSLL
KDLFNDLSKMIEEKILSNSALGDNFKSYSPRAVARMILGAMFGTGIQVILDSNENEILDA
LNAIQIIFE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaagaaaccaatcacaaagaatattaaatgctgcatataaatgcatttcaact
aaaggctatgctaatgtttcgttaagagatattgcagaggaagctggtgttgtattaagc
caattgcattattattttggtagtaaggaagggctttttacagaggtaataaagatgatg
atagataaatatttagaagaaataaatgaagctttgagtattggagaaactgcaaaggat
aagatgctatccttagtgaaattttttaaagacctgttaagtaataatccgggacttttt
aaactgttgtacgattttacaggtttagccatgtggtcctcttcttttaacagtttatta
aaggatttatttaatgatttatctaaaatgattgaggaaaaaattttaagtaatagtgct
ttaggagacaattttaaaagttattctccacgagcagtagcgagaatgatacttggtgca
atgtttggtacgggaattcaagtgattttagattctaatgaaaatgaaattttggatgcg
ttaaatgccatacaaattatttttgagtaa

DBGET integrated database retrieval system