KEGG   Thermoanaerobacter brockii: Thebr_1063
Entry
Thebr_1063        CDS       T01409                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tbo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Thebr_1063
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tbo01007]
    Thebr_1063
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tbo03016]
    Thebr_1063
   03029 Mitochondrial biogenesis [BR:tbo03029]
    Thebr_1063
Enzymes [BR:tbo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     Thebr_1063
Amino acid related enzymes [BR:tbo01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   Thebr_1063
Transfer RNA biogenesis [BR:tbo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Thebr_1063
 Prokaryotic type
   Other AARSs
    Thebr_1063
Mitochondrial biogenesis [BR:tbo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Thebr_1063
SSDB
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon NAF tRNA-synt_2e
Other DBs
NCBI-ProteinID: ADV79639
UniProt: E8USB0
LinkDB
Position
1091968..1093746
AA seq 592 aa
MGEQLNGLKRTHMCGELTVEDVDKSVVVMGWVQRRRDHGGLVFIDLRDRTGIVQVVFSNE
VSSEAFEKVQSVRSEYVLAIEGKVVKRAPENVNPKISTGEIEIYANTLKILSKSETPPFP
IEDRSNVSEAIRLKYRYLDLRRPSMQQNLMTRFKITKVVRDFLNRNGFIEIETPLLIKST
PEGARDYLVPSRIYPGKFYALPQSPQIFKQLLMISGFDKYYQIAKCLRDEDLRADRQPEF
TQIDIEMSFVEVEDVLKINEKMIAEIFKETLGIDVPIPFKRLSYQESMERFGTDKPDLRF
GMELKDLSDIVAQSEFNVFKTALKNNGSVRGINVKGAASMPRRQLDELVEFAKTYGAKGL
LWIQVFEKEVKSPATKFLSEEEMKKILERLEAEAGDLLLIVADKDEIVFDTLAHLRLELG
KRFNLIDENKYEFVWIVDFPLLEYDEGEKRYVAKHHPFTAPKDEDIELLEKEPLKVRAKA
YDIVLNGTEIGGGSIRIHDTELQKRMFKVLGFSEEKAWERFGFLMEAFKYGAPPHGGIAY
GLDRLAMIITGSDTIRDVIAFPKTQNAVCLMTDAPSEVSEEQLKELHIKVDL
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgggagaacaattaaatggccttaaaagaactcacatgtgtggagaattgacagttgaa
gacgtagataagtcagttgtagtaatgggatgggtgcaaaggagaagagaccatggagga
ttagtatttatagatttaagagatagaacaggcattgtgcaggtggtttttagcaatgag
gtttcttctgaagcctttgaaaaagtgcaaagcgtaagaagtgaatatgtactggcaata
gagggaaaagtggtaaaaagggctccggaaaatgtaaatcctaaaatttctacaggagaa
attgaaatatatgctaatactttaaaaattttaagcaaatcagagactccgccttttcca
atagaggataggagcaatgtatcagaagctataaggttgaaatacagatacttagatttg
agaaggccttcaatgcaacaaaatttgatgactcggtttaaaataactaaagttgtccgc
gattttttaaacagaaatggttttatagaaatagaaactcctcttttaattaaaagtact
ccagaaggggcaagggactatcttgtaccgagtagaatttatccaggaaaattttatgct
ttgcctcaatctcctcaaatattcaaacaacttcttatgatttctggatttgataagtat
taccaaatagccaaatgtttaagagatgaggatttaagagcagataggcaaccagagttt
acacaaatagatatagaaatgtcttttgtagaagtagaagatgttttgaaaattaacgaa
aaaatgattgcagagatatttaaagagactttaggcattgatgtaccaattccttttaaa
agattatcttatcaagaatctatggaaagatttgggacagataaaccagacttgaggttt
ggaatggaacttaaggatttatctgatatagtggcacaatcagaatttaatgtgtttaag
actgctttaaaaaataacggttctgtgagaggtataaatgtaaaaggtgctgcttctatg
ccaagaagacagttggacgaactggtagagtttgcaaaaacttatggcgctaaaggactt
ttgtggatacaagtttttgaaaaggaagtgaaatctcctgctactaaatttttaagtgaa
gaagaaatgaagaaaatactcgaaagacttgaggcagaagccggagatttgctactaatt
gtggcagacaaagatgaaatagtttttgatactttagctcatttgaggctagagcttggc
aagagatttaatttaattgatgagaataaatatgagtttgtttggatagtagattttcca
cttttagagtacgacgaaggagaaaaaaggtatgtagcaaagcaccatccttttactgct
cctaaagatgaagatatagagctactggaaaaggaacctttaaaagtcagggcaaaggct
tatgacatagttttaaatggtacagagattggtggaggaagtataaggatacacgatact
gagcttcaaaaaagaatgtttaaagttttgggatttagcgaagaaaaagcgtgggaaaga
tttggatttttgatggaggctttcaaatacggtgctcctccccatggaggtatagcttat
gggttggataggcttgcaatgattataacgggaagcgacaccataagggatgtaattgca
tttccaaagactcaaaatgcagtgtgcttgatgacagatgctccttctgaggtttcagaa
gagcagttaaaggaattgcacataaaggtagacctataa

DBGET integrated database retrieval system