KEGG   Thermoanaerobacter brockii: Thebr_1305
Entry
Thebr_1305        CDS       T01409                                 

Definition
(GenBank) ribosomal protein S16
  KO
K02959  small subunit ribosomal protein S16
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tbo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Thebr_1305
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tbo03011]
    Thebr_1305
   03029 Mitochondrial biogenesis [BR:tbo03029]
    Thebr_1305
Ribosome [BR:tbo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    Thebr_1305
  Bacteria
    Thebr_1305
Mitochondrial biogenesis [BR:tbo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Thebr_1305
SSDB
Motif
Pfam: Ribosomal_S16
Other DBs
NCBI-ProteinID: ADV79879
UniProt: E8UTG8
LinkDB
Position
complement(1307740..1308000)
AA seq 86 aa
MAVRIRLKRFGAKKRPFYRIVVADSRSPRDGRFIDEIGYYNPIAQPAEIKIDVEKAKKWL
SVGAQPSDTVKSLFKKEGIIGNSASQ
NT seq 261 nt   +upstreamnt  +downstreamnt
gtggcagtcagaataagattaaaaaggtttggggctaagaaaagacctttttacaggata
gtagtagcagattcaaggtcaccaagagatggaaggtttattgatgagataggatattac
aatcctatagcccagcctgctgaaataaaaatagatgttgaaaaggctaaaaagtggctt
agtgttggtgcccaaccttcagatactgtaaagtcactgtttaaaaaagaaggtataatt
ggcaatagtgcatctcaataa

DBGET integrated database retrieval system