KEGG   Thermoanaerobacter brockii: Thebr_1322
Entry
Thebr_1322        CDS       T01409                                 

Definition
(GenBank) ribosomal protein L32
  KO
K02911  large subunit ribosomal protein L32
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tbo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Thebr_1322
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tbo03011]
    Thebr_1322
   03029 Mitochondrial biogenesis [BR:tbo03029]
    Thebr_1322
Ribosome [BR:tbo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Thebr_1322
  Bacteria
    Thebr_1322
Mitochondrial biogenesis [BR:tbo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Thebr_1322
SSDB
Motif
Pfam: Ribosomal_L32p DZR DUF1272 zinc_ribbon_2 zf-NADH-PPase zf-ribbon_3 Zn_Tnp_IS1595 Ribosomal_L37e OrfB_Zn_ribbon
Other DBs
NCBI-ProteinID: ADV79896
UniProt: E8UTI5
LinkDB
Position
complement(1323746..1323928)
AA seq 60 aa
MPVPKRRTSKARRDTRRNNSYKIAAPAYVLCPRCHEPKLPHRVCPNCGYYKDREVIKVEE
NT seq 183 nt   +upstreamnt  +downstreamnt
atgccagttccaaagaggaggacatcaaaggctagaagagataccagaaggaataatagt
tataaaatagctgcaccggcttacgttttgtgtccaagatgtcatgagcctaaactacct
catagagtatgtccaaactgcggctattacaaagatagagaggtaataaaagtagaagag
taa

DBGET integrated database retrieval system