KEGG   Thermoanaerobacter brockii: Thebr_1389
Entry
Thebr_1389        CDS       T01409                                 

Definition
(GenBank) glycyl-tRNA synthetase
  KO
K01880  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tbo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Thebr_1389
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tbo01007]
    Thebr_1389
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tbo03016]
    Thebr_1389
   03029 Mitochondrial biogenesis [BR:tbo03029]
    Thebr_1389
Enzymes [BR:tbo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     Thebr_1389
Amino acid related enzymes [BR:tbo01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   Thebr_1389
Transfer RNA biogenesis [BR:tbo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Thebr_1389
Mitochondrial biogenesis [BR:tbo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Thebr_1389
SSDB
Motif
Pfam: HGTP_anticodon tRNA-synt_2b HypA zf-ribbon_3
Other DBs
NCBI-ProteinID: ADV79962
UniProt: E8UTX5
LinkDB
Position
complement(1392827..1394215)
AA seq 462 aa
MPQAVTMDKIVALAKNRGFVFPGSEIYGGLANTWDYGPLGVELKNNIKRMWWKRFIQQSP
YNVGIDSAILMNPEVWVASGHVSSFSDPLMDCKECKSRFRADQLIEDYIKEKGLNISIEG
WTNEQMMEFIKEHKVSCPKCGAHNFTDIRKFNLMFKTYQGVTEDSKSEVYLRPETAQGIF
VNFKNVQRTTRKKIPFGIGQIGKSFRNEITPGNFIFRTREFEQMELEFFCKPGEDMEWFS
YWRKYCMDWLLEFGLKEENLRFRDHKKEELSHYSTATTDIEYNFPFGWGELWGIANRTDF
DLRQHMEHSGVDLSYMDPVTGEKYIPYCIEPSVGVDRLMLAFLIDAYEEEELEDGETRVV
LRLHPALAPIKAAVLPLSKKLSENAYKLYDQLRNKFVVDYDETGSIGKRYRRQDEIGTPF
CITYDFDSENDHCVTIRDRDTMQQVRIKIEEVEKYLEERLNF
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgccacaagcagttacaatggataaaatagttgcccttgcaaaaaacagaggatttgtt
tttccagggtctgaaatatacggaggacttgctaatacttgggattatggacctctggga
gtagaacttaaaaacaatattaaaaggatgtggtggaaaagatttattcaacaaagtcct
tataacgtagggattgattctgcaattttgatgaatccagaagtgtgggttgcatcaggt
catgttagcagttttagcgatcctttaatggactgtaaagagtgtaaatcaagatttaga
gctgaccaattgattgaagactacattaaagaaaagggattaaatatttctattgaaggt
tggacaaatgaacaaatgatggaatttataaaagaacataaagtatcttgtccaaaatgt
ggtgcccataattttactgatattaggaagtttaatctcatgtttaaaacctatcaaggt
gttacagaagactctaaatcagaagtgtatttgcgacctgaaaccgcacaaggaattttt
gtgaactttaaaaatgttcaaaggacaactcgtaagaaaataccttttggaataggacaa
attggtaaatcttttagaaatgaaattactcctggtaatttcatattcagaacgagagaa
tttgaacagatggaattagaatttttctgtaaaccgggagaagatatggaatggtttagt
tactggagaaaatattgcatggattggcttttagaattcggcttaaaagaagaaaattta
agatttagagaccataaaaaagaagaactatctcactatagtactgccaccacagacata
gaatataattttccctttggatggggagagttgtggggaatagctaatagaacagatttt
gatttaaggcaacatatggaacattcgggagttgacctgtcttatatggaccctgtaaca
ggagaaaagtacataccatattgcattgagccttctgttggggtagataggttaatgttg
gcatttttaatagatgcctatgaagaagaagagttagaagatggagaaactagagtggtt
ttaaggcttcatcctgctcttgctcccattaaggcagcagtgcttccattatccaagaaa
ttatcagaaaatgcctataagctttatgaccagttgagaaataaattcgtagtagattac
gatgagacaggaagcataggtaaaaggtatagaagacaggatgagataggcacgcctttc
tgtattacttatgactttgattcggaaaatgatcactgtgtaaccataagagatagagat
actatgcaacaagtgagaataaaaattgaagaagtagagaaatatcttgaagaaaggtta
aatttttaa

DBGET integrated database retrieval system