KEGG   Thermoanaerobacter brockii: Thebr_1393
Entry
Thebr_1393        CDS       T01409                                 

Definition
(GenBank) GTP-binding protein Era
  KO
K03595  GTPase
Organism
tbo  Thermoanaerobacter brockii
Brite
KEGG Orthology (KO) [BR:tbo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tbo03009]
    Thebr_1393
   03029 Mitochondrial biogenesis [BR:tbo03029]
    Thebr_1393
Ribosome biogenesis [BR:tbo03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   Thebr_1393
 Prokaryotic type
  GTPases
   Thebr_1393
Mitochondrial biogenesis [BR:tbo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Thebr_1393
SSDB
Motif
Pfam: MMR_HSR1 KH_2 FeoB_N Dynamin_N GTP_EFTU RsgA_GTPase AIG1 MMR_HSR1_Xtn PduV-EutP Ras cobW AAA_22 SRPRB AAA_15 Roc ABC_tran AAA_29 KH_4 ATP_bind_1 AAA_21 AAA_23 KH_1 Septin FtsK_SpoIIIE
Other DBs
NCBI-ProteinID: ADV79966
UniProt: E8UTX9
LinkDB
Position
complement(1396210..1397118)
AA seq 302 aa
MGHKAGFVALVGRTNVGKSTLLNAILQEKIAITSPKPQTTRNTIRGILTTDEYQVIFVDT
PGIHKPKSKLSEFMIEVAKRTLKEVDLILYMIEPDTEVGPGDRYIIEHLKEVDTPVILVV
NKIDLVPEKRVEETIKIFKEQYEFKDVVAISAIENKNIDLLKEKIVSLLPEGPKYYLDDY
ITDQPEKLIVAEIIREKMLHFLEEEVPHGVYVEVESIKEREDKDIIDIEAYIYCEKESHK
GIIIGKNGQMLKKIGQSARLDLEEFYGKQVFLDLWVKTRKGWRDNTTLLKKLGYAIDKKT
YE
NT seq 909 nt   +upstreamnt  +downstreamnt
atgggccataaagctggttttgtagcattagttggtagaactaatgtaggtaaatctact
cttttaaatgcaattttacaagagaagattgctattacttctcccaaaccccaaactact
cgaaataccattcgtgggattttgacaacagatgaataccaggttatttttgttgacact
cctggcattcataaacctaaatctaaattaagcgaatttatgattgaggtagctaaaaga
acattgaaggaagttgaccttattttgtatatgatagaaccagatacggaagtaggacct
ggagatagatacataatcgaacatttaaaagaagtagatacacctgtcatacttgtagtc
aacaaaatagatttggtgcctgagaaaagagtagaagagactataaaaatttttaaagag
caatatgagtttaaagatgtagtagctatttctgctattgaaaataaaaatatagatttg
ttaaaagaaaaaattgtatcacttttgccagaaggccccaaatattatttggatgattat
ataacagatcagcccgaaaaattaatagtggcagaaataattcgagagaagatgttacac
tttttagaggaagaagtacctcacggtgtttatgtggaagtagaatctattaaagagagg
gaagataaagatataatagacattgaagcatatatttactgtgagaaagagtcccacaaa
ggaattattataggcaaaaatgggcaaatgctaaaaaagataggtcaaagtgcgcgactt
gatttagaagaattttatggaaaacaggtttttcttgacctatgggtaaagacgaggaag
gggtggagagacaatacaacgttacttaaaaaattaggatatgccattgacaagaaaact
tacgaatag

DBGET integrated database retrieval system