KEGG   Thermoanaerobacter brockii: Thebr_1734
Entry
Thebr_1734        CDS       T01409                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, C subunit
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo00970  Aminoacyl-tRNA biosynthesis
tbo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Thebr_1734
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tbo03029]
    Thebr_1734
Enzymes [BR:tbo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Thebr_1734
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Thebr_1734
Mitochondrial biogenesis [BR:tbo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Thebr_1734
SSDB
Motif
Pfam: Glu-tRNAGln
Other DBs
NCBI-ProteinID: ADV80271
UniProt: E8UVL9
LinkDB
Position
complement(1721936..1722223)
AA seq 95 aa
MAISRSEVEHVAKLARLKFSQEEIEEFTVQLSKIIDYVNKLNELDTENVEPTAHIVPIHN
VFREDEVKPSMDRDKILMNAPYKENGCFKVPKIIE
NT seq 288 nt   +upstreamnt  +downstreamnt
atggctattagtaggagcgaagttgagcatgtggctaaactggcccgtctcaaattttcg
caagaggaaatagaagagtttacagtgcaactgagcaaaattatcgactatgtaaacaaa
ttaaacgaattggacactgaaaatgtagagcctacagctcatatagtgccaatccataat
gtatttagagaagacgaagtaaagccttcaatggacagagacaaaatattgatgaatgca
ccttataaagagaacggatgctttaaagtgcctaagattatagaatga

DBGET integrated database retrieval system