KEGG   Thermoanaerobacter brockii: Thebr_1810Help
Entry
Thebr_1810        CDS       T01409                                 

Definition
(GenBank) extracellular solute-binding protein family 3
  KO
K23059  arginine/lysine/histidine transporter system substrate-binding protein
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:tbo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Thebr_1810
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tbo02000]
    Thebr_1810
Transporters [BR:tbo02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Arginine/lysine/histidine transporter
    Thebr_1810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd NMT1 NMT1_3 LysR_substrate DUF3236
Motif
Other DBs
NCBI-ProteinID: ADV80345
UniProt: E8UW18
LinkDB All DBs
Position
complement(1799297..1800082)
Genome map
AA seq 261 aa AA seqDB search
MNKKTLFVFLTMTIILGLILSACGNKPANTLDKIKEKGVIVMGTSADFPPYEFHKVEGNK
DTIVGFDVDIANAIAKKLGVKLEIKDMDFKGLIPALQAGRIDMAIAGMTPTPERAKSVDF
SDLYYDSKQVVVVRNDSPISKFDDLKGKTVAVQIGTTSEEAAKKIPDVKLKQLNRVGDAF
MDLKNGRCDAIVLENTVANAYLKEYKDMKILNMKEINTVENGSAVAVAKGNKELVNIIND
VIKELKASGEYDKLIDKWFKQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaaacattatttgttttcttaacaatgacaattattttgggtttaatttta
tccgcttgtggcaacaaaccagctaatactttggacaaaattaaggaaaaaggcgttatc
gtaatgggaacaagtgcagattttccaccttatgagttccataaagtagaaggaaacaaa
gatacaatagtgggttttgacgttgatatagcaaatgccattgcgaaaaaattaggggtt
aagctggagataaaagatatggactttaaaggattgattccagctcttcaagctgggcgc
atagatatggcgattgctggaatgactccaacaccggagagggctaaaagtgttgatttt
tcagacctttattatgatagtaaacaagtggtagtagtgcgtaatgacagtcctatttcc
aaatttgatgacttaaaaggcaaaactgttgcagtgcaaataggcaccacctctgaagaa
gctgctaaaaagataccggatgtaaaattgaagcagctaaatcgtgttggagacgctttt
atggatttaaagaatggcagatgtgatgcgatagtattggaaaatactgtagcaaatgca
tatctcaaagaatacaaggacatgaagatacttaacatgaaagaaatcaacacggtagaa
aatggttctgctgttgcagtagctaaaggaaataaagaattagtgaatataataaacgat
gtgataaaagagttaaaagcaagtggcgaatatgacaaacttatagataaatggtttaag
caatga

DBGET integrated database retrieval system