KEGG   Thermoanaerobacter brockii: Thebr_1832Help
Entry
Thebr_1832        CDS       T01409                                 

Definition
(GenBank) Flagellar operon protein YvyF
Organism
tbo  Thermoanaerobacter brockii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zinc-ribbons_6 DZR HypA RecR DUF35_N C1_2 C1_1 zf_UBZ Sgf11 tRNA-synt_1g
Motif
Other DBs
NCBI-ProteinID: ADV80367
UniProt: E8UWB6
LinkDB All DBs
Position
complement(1820418..1820834)
Genome map
AA seq 138 aa AA seqDB search
MEIRNCKRCGRLYTYTGIDLCPVCYRQDEEDFMKVRDYLDTHPSATMLEISQNTQVSTKK
IMDFLKEGRLILTSNNVNIGLRCERCGKPILTGRFCDECKTKLAKELMKGYSIQSDDKEE
EKQTGERLYVYENQKKKK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggaaataagaaattgtaaaaggtgcggaaggctttacacgtacacaggaattgaccta
tgtccagtgtgctatagacaggatgaagaagattttatgaaagtgagggattatttagat
acacatccctcggctaccatgctggaaatatctcaaaatacacaggtttctacaaagaaa
ataatggattttttaaaggaaggcaggcttattttaacctctaataacgtcaatataggt
cttaggtgcgaaagatgtggtaaaccaatacttacaggtaggttttgtgacgagtgcaaa
accaaattagctaaggaattaatgaaaggctattcgattcaatccgatgacaaagaagaa
gaaaaacaaacaggagaaagactgtacgtttatgagaatcaaaaaaagaaaaaatga

DBGET integrated database retrieval system