KEGG   Thermoanaerobacter brockii: Thebr_2003
Entry
Thebr_2003        CDS       T01409                                 

Definition
(GenBank) leucyl-tRNA synthetase
  KO
K01869  leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tbo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Thebr_2003
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tbo01007]
    Thebr_2003
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tbo03016]
    Thebr_2003
   03029 Mitochondrial biogenesis [BR:tbo03029]
    Thebr_2003
Enzymes [BR:tbo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     Thebr_2003
Amino acid related enzymes [BR:tbo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Thebr_2003
Transfer RNA biogenesis [BR:tbo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Thebr_2003
 Prokaryotic type
    Thebr_2003
Mitochondrial biogenesis [BR:tbo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Thebr_2003
SSDB
Motif
Pfam: tRNA-synt_1 tRNA-synt_1_2 tRNA-synt_1g Anticodon_1 tRNA-synt_1e DZR HypA TackOD1 IBR zf-ACC Enolase_N
Other DBs
NCBI-ProteinID: ADV80522
UniProt: E8UQV2
LinkDB
Position
complement(2001704..2004154)
AA seq 816 aa
MAYSVEIDRKWQKRWEETKLYKFNPKNVDKKLYCLEMFSYPSGAKLHVGHWYNYGPTDSW
ARMKRMQGWEVFHPMGFDAFGLPAENYAIKTGIHPYDSTMENIRTMEKQLKEMGATFDWD
YEVITCLPEYYKWTQWIFLKLFEAGLAYRKKAPVNWCPSCQTVLANEQVIDGKCERCGTE
VTKKDLTQWFFKITAYAEELLEKLDELDWPEKTKIMQRNWIGKSDGAEIEFKVAGKDLTF
KVFTTRADTLYGATYVVIAPEHEIVDLITTEEYKQAVEEYKEYARKQSEIERLSTEKEKT
GVFTGAYAIHPLTGEKLPIWIADYVLATYGTGCVMAVPAHDKRDYEFATKYNLPIKRVIK
GIGDVEDSLPFDEYGVLVDSGEFAGLKSEEARIKIVEKLKQEGRAEFKVNYRLRDWLVSR
QRYWGAPIPVIHCERCGIVPVPEEDLPVLLPYDVEFAPTGESPLKKHEGFMNVTCPKCGG
KALRDPDTLDTFVDSSWYFLRYPDNKNDKEPFNKEWINKMLPVDKYVGGAEHATMHLLYA
RFVTKALRDLGYLDFDEPFKSLVHQGTILGPDGSRMSKSKGNVISPDEYIKEYGSDVFRL
YLMFGFAYSEGGPWNDDGIKAIARFVNRVERFIDKFIETRNNPGKIKDDMGKDEKELNYV
RHYAIKGVTEDAERFQFNTAIARIMELVNALYKYEADVEVKNIKFYEEVVADLIKLLAPF
APHFSEEMWEKLGYEYSVFNQKWPEWDEKALQRDVVEIAVQVNGKVRGRLEVPSKATDEE
IEKLALSDKNVKAYVDGKEIKKVIVVKNRLVNIVVK
NT seq 2451 nt   +upstreamnt  +downstreamnt
atggcgtattcggttgaaattgatagaaaatggcaaaaaagatgggaagagacaaaactt
tataagtttaatcctaaaaatgtagataaaaagctttattgccttgagatgttttcttat
ccttcaggtgccaagcttcacgtaggacattggtacaattatggacctactgattcttgg
gcgagaatgaaaagaatgcaaggatgggaagtttttcatccaatgggatttgacgctttt
ggacttcctgcagaaaactatgccataaagacgggaatacatccttatgattccaccatg
gaaaatataaggacgatggaaaagcagcttaaagaaatgggggcgacttttgattgggac
tatgaagtaataacttgcttaccggaatactacaaatggacgcagtggattttcttgaag
ctttttgaggcaggccttgcctatagaaaaaaagcgccagtgaattggtgtcccagttgt
caaactgttcttgcaaacgaacaagttatagatgggaaatgtgaaaggtgcggcactgaa
gttacaaagaaagatttgactcagtggttttttaagataactgcttatgcagaagaactc
cttgaaaaactggatgaacttgattggcctgagaagacaaaaataatgcagagaaattgg
attggaaagtcggatggagcagagatagaatttaaagtagccggaaaagacctgacattt
aaggtatttactacaagagctgacacgttgtatggagcgacgtatgtagttattgcgcca
gaacacgaaattgtagatttaattactacagaagaatataaacaagctgttgaagagtat
aaagaatacgcgagaaaacagagtgagattgaaaggttgtctactgaaaaagaaaagaca
ggggtatttacaggagcatacgcaattcatcctctgacgggagagaaactccctatttgg
atagcagactatgtccttgcaacatatggaacaggatgtgtcatggctgttcctgcccat
gataaaagagattatgagtttgcaacaaaatacaaccttcctataaaaagagtgataaaa
ggaattggagatgtggaggacagtctaccctttgatgagtatggagtgcttgtagacagt
ggagaatttgcaggtttgaaatcagaagaagcgaggataaaaattgtagaaaaattaaaa
caagaaggtagagcagagtttaaagtaaattacagattgagggattggcttgtttcaagg
cagagatactggggcgctccaatacctgttattcactgtgaacgctgtggcatagtccct
gtcccagaagaagatttaccagtgttactcccttatgatgtggaatttgctccaacaggt
gaatctccacttaaaaagcatgaaggctttatgaacgttacttgtcccaaatgtggtggc
aaggctttaagagaccctgatacgttggacacttttgtggattcttcgtggtactttttg
agatatcccgataacaaaaacgacaaagagcctttcaataaagaatggataaataaaatg
ttgcctgttgacaagtacgtaggtggagcagagcacgcgacaatgcatcttttgtacgca
aggtttgttacaaaggctttgagagacttaggatatcttgactttgatgagccgtttaaa
tctttggtgcatcaaggcacaatattgggacctgatggcagcagaatgagcaaatctaaa
gggaatgtaatttcgcctgacgaatacattaaagaatacggttctgatgtatttagactc
tatctgatgtttggatttgcttattctgaaggtgggccatggaatgatgatggaataaaa
gccattgcaaggtttgtcaacagagtggagagatttatagataaattcatagagacaaga
aacaatcctggaaaaataaaagatgatatggggaaagatgaaaaagagttaaactatgtg
agacattatgctataaaaggtgtgacagaagatgcagagagatttcagtttaatactgca
atagcgaggataatggaactggtaaatgccctttataaatacgaggcagatgtggaagtt
aaaaatatcaaattttatgaagaagtggtggcagatttaataaaacttttggcgccattt
gctcctcacttttctgaagaaatgtgggaaaagcttggatatgaatattctgtcttcaat
cagaaatggcctgagtgggatgaaaaagctctacaaagagatgttgtagaaatagctgtg
caggtaaacggcaaggtaagggggagacttgaagttccttcaaaagctactgacgaagaa
atagaaaagctcgctctttctgataaaaatgtaaaagcatatgtggatggaaaagagata
aagaaggtcatagttgtcaaaaacaggcttgtaaatattgttgtgaaataa

DBGET integrated database retrieval system