KEGG   Thermoanaerobacter brockii: Thebr_2320
Entry
Thebr_2320        CDS       T01409                                 

Definition
(GenBank) ribosomal protein S6
  KO
K02990  small subunit ribosomal protein S6
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tbo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Thebr_2320
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tbo03011]
    Thebr_2320
   03029 Mitochondrial biogenesis [BR:tbo03029]
    Thebr_2320
Ribosome [BR:tbo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    Thebr_2320
  Bacteria
    Thebr_2320
Mitochondrial biogenesis [BR:tbo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Thebr_2320
SSDB
Motif
Pfam: Ribosomal_S6 BRCT_2 PTCB-BRCT
Other DBs
NCBI-ProteinID: ADV80822
UniProt: E8USK1
LinkDB
Position
complement(2325505..2325792)
AA seq 95 aa
MRSYETMYILSPDLSEEERKGLIERFKNLIIENGGEITNFDEWGKRKLAYLIDKKPEGYY
VLMNFNSDSKVSQELERVYKITDGVLRYLIIRTDE
NT seq 288 nt   +upstreamnt  +downstreamnt
atgaggtcatacgagacaatgtacattctctctccagatttaagtgaagaggaaagaaaa
ggcttaatagaaagatttaaaaacctcatcattgaaaatggtggagaaataaccaatttt
gatgaatggggtaagagaaaattagcctatctaattgacaaaaagcctgagggatattat
gtactgatgaactttaacagcgactcaaaggtttctcaggaattggagagagtttataag
atcacagatggcgttttgagatatttaataataagaactgacgaatga

DBGET integrated database retrieval system